http://www.iphods.com/movie/524/secretary-thing/ http://www.iphods.com/videos/a0ef57b10f290c8d9d4bb52063d672bc.m4v http://www.iphods.com/clips/thumbs/a0ef57b10f290c8d9d4bb52063d672bc.jpg Secretary Thing 2009 AVN Award Nominee for Best Vignette Release Special Note: This Is Movie # 100,000 In Our VOD Library!!! Patrick Collins proudly presents, It's A Secretary Thing, a collection of stunning superstars dressed up as seductive secretaries. Watch the curvaceous Shyla Stylez, alongside Jenaveve Jolie, Karlie Montana, Carli Banks, Ashley Blue, Evie Delatosso, and Jamie Lamore. It's a Secretary Thing is a depiction of fantasy role-playing at its best. In an industry that is over saturated with unoriginal couch sex, Patrick Collins focuses on creative scenarios, chemistry between performers and real female orgasms. His movies are unlike anything else in porn. 4.5 12 2009-08-13 Mature Adult Noplayorgasmspornfemalestylenomineesecretashleyfantasyreleaseavn awardaward nomineecollectioncarlicollinssuperstarmalemoviesoriginal100%blue http://www.iphods.com/movie/4/rick-savage-slave-training-101-tit-torture-caning/ http://www.iphods.com/videos/20ceca56b6971037705ec16891df7673.m4v http://www.iphods.com/clips/thumbs/20ceca56b6971037705ec16891df7673.jpg Rick Savage Slave Training 101: Tit Torture and Caning Pretty bondage virgin, Giselle, a country girl from Canada (by way of Minnesota) has entrusted her cherubic body to the wicked Master Savage for her first voyage into the world of bondage and discipline. Her slave training begins with the simple command, "Pick up your skirt and show me your ass." She obeys, and the camera views a set of meaty buttocks ideal for caning. A good spanking, paddling and caning will definitely be part of Giselle's slave training today. She obediently strips off her skirt and blouse. She is collared, a leash attached and she is taken for a walk around the dungeon. She obeys all commands, demonstrating the potential to become a good slave. Affixed to the St. Andrews cross, she receives her first taste of flogging on her back and succulent tush. Her little squeals of pain are music to the ears of any sadist. Savage commands her to push her butt out to receive punishment from his heavy leather flogger. She obeys and shortly her ass cheeks are a nice shade of glowing pink, in 3.5 9 2009-07-08 Mature Adult Nopussylovespankingtitsbondagebeautifulpunishmentboundpainslavehandsleatherbodynicecaningdeepmasterfinallyprettytorturecamerabuttlovestrainingropeshortfingerusedbarepaddleheavy,release,submission,pulls,dungeon,fingers,breasts,vibrator,boobs,clothes,ball,nipple,extreme,view,taken,decide,truly,music http://www.iphods.com/movie/274/soccer-moms-spank-off/ http://www.iphods.com/videos/0246d2fa4d85265c187ae73eb1c73347.m4v http://www.iphods.com/clips/thumbs/0246d2fa4d85265c187ae73eb1c73347.jpg Soccer Mom's Spank Off This is the second video featuring web mistress, Clare Fonda and Chelsea Pfeiffer Now, the kid gloves are off! This is a much more aggressive video all around. One spankee even cries real tears while the other is left with a visibly bruised bottom! Maggie Brown (Clare Fonda) visits Lana White (Chelsea Pfeiffer) hoping she can "persuade" Lana to take her son out of the running for a soccer scholarship. But Lana thinks Maggie's proposal is perfectly unethical and outrageous: In the interest of sportsmanship and fair play, Lana tries to spank the badness out of Maggie Brown! In the second scene, Maggie Brown, having endured a long hard spanking, with hand and hairbrush, is threatening to tell all the other soccer moms about the treatment she's received at the hand of Mrs. White. Considering the possible ramifications, Lana decides to allow Maggie to spank her in return for Maggie keeping her big mouth shut! And so, Maggie spanks Lana with all her might in revenge for the burning spanking she has just received 3 9 2009-01-09 Mature Adult Nospankingmistressvideoevenplaywhitemouthbottomspankslovessecondhairhairbrushmomsdeciderevenge http://www.iphods.com/movie/490/sunny-lane-anal/ http://www.iphods.com/videos/a48e38367f4a17a2838f067a86413651.m4v http://www.iphods.com/clips/thumbs/a48e38367f4a17a2838f067a86413651.jpg Sunny Lane Anal 2009 AVN Award Winner for Best Anal Scene and 2009 AVN Award Winner for Best Big Butt ReleaseBig Wet Asses, the winner of AVN's coveted Best Anal Themed Series award for 2006, 2007, and 2008, is back! Elegant Angel is delighted to announce that porn superstar, Sunny Lane, stars in the thirteenth edition of the critically acclaimed series, performing in her very first, highly anticipated anal scene, alongside another stellar assemblage of voluptuous superstars. The curvaceous and fair-haired beauty, Sunny, performs with former AVN, male performer of the year, Manuel Ferrara. The scene is thirty five minutes of scorching hot, passionate sex, featuring plenty of balls to the wall, hardcore anal. The on set chemistry between Sunny and Manuel is electric. "I'm so happy," said Sunny. "It was such a great scene, and I was so excited and turned on. This scene was all I could think about last night. I had definitely been practicing over the past couple of weeks while thinking about Manuel's big cock penetrating my ass 2.5 9 2009-08-25 Mature Adult Nogirlsballsanalhardcoreorgasmorgasmspornwhitebuttnightkellyhighawardwinnerangelhaircallreleasehappyavn awardasseselegant angelpassionatehardcore analcouplesuperstarmaleballvoluptuousaward winner http://www.iphods.com/movie/546/taboo-charming-mother-vol-6-immoral-tears/ http://www.iphods.com/videos/bcd97baef51aab1dc2739b66952c30e0.m4v http://www.iphods.com/clips/thumbs/bcd97baef51aab1dc2739b66952c30e0.jpg Taboo Charming Mother Vol. 6 - Immoral Tears 2009 AVN Award Nominee for Best Animated Release Kazuhiko continues the sexual rendezvous with his stepmother's sister, his aunt Emiko. Now his stepmother Misako's jealousy grows by the second. She soon realizes that she no longer needs her husband Yosuke. Instead, the one she truly desires both mentally and physically is Kazuhiko, however she only has a few days to make a decision whether to be his lover or go back to being a normal family.This movie is featured in the original Japanese with English subtitles. 3 9 2009-08-01 Mature Adult Nonomineeawardsecondhusbandreleasejapaneseavn awardaward nomineefeaturedcontinuesloverfeatureoriginaltruly http://www.iphods.com/movie/578/moms-a-cheater-volume-3/ http://www.iphods.com/videos/dd571cd5fafc88b7843346febfada6b0.m4v http://www.iphods.com/clips/thumbs/dd571cd5fafc88b7843346febfada6b0.jpg Moms A Cheater Volume 3 You thought your best friend's mom was a goody-two-shoes? Well, THINK AGAIN! Watch hot, sexy MILFs run around like wild whores, fucking like wild animals and cheating on their loser husbands. Enjoy! 2.5 9 2009-07-16 Mature Adult Nosexyfuckingwildwhoreshusbandmilfmilfsshoes http://www.iphods.com/movie/463/nina-hartley-milf-trainer/ http://www.iphods.com/videos/85be6372c6095615a4fa78d156fe260c.m4v http://www.iphods.com/clips/thumbs/85be6372c6095615a4fa78d156fe260c.jpg Nina Hartley: MILF Trainer Blu-Ray Version. Get out a pencil and paper, because porn legend Nina Hartley is about to school you in the ways of the MILF. Watch her and her MILF crew fuck and suck a cock like it should be! Nina is the fuck of a lifetime! Watch her supple ass bounce a rock hard cock! 3 8 2009-09-03 Mature Adult Nocockschoolsuckrock hardhard cockmilfnina http://www.iphods.com/movie/527/flower-squirt-shower-6/ http://www.iphods.com/videos/585857414015a4cdd87c9efb31555447.m4v http://www.iphods.com/clips/thumbs/585857414015a4cdd87c9efb31555447.jpg Flower Squirt Shower 6 2009 AVN Award Nominee for Best Squirting ReleaseThe AVN award winning series, Flower's Squirt Shower, returns with the sixth volume, starring the goddess of gush, porn super star Flower Tucci. Volume's 2 and 3 have both been recipient's of AVN editor's choice reviews, and at this year's AVN awards the series won for Best Specialty Release - Squirting. Squirt Shower 6 is bigger, better, and wetter than ever. Featuring a squirt drenched bevy of beautiful starlets including Jada Fire, Sindee Jennings, Britney Stevens, Nicki Hunter, and Gianna. While there are many imitators, Elegant Angel is the company that porn fans can rely upon for squirting movies that celebrate female orgasms with camera work that doesn't stay wide when you want it to get up close and intimate. Director William H.'s camera lens is once again squirt soaked, as Flower Tucci subjects us to a relentless onslaught of female ejaculation. 5 8 2009-08-12 Mature Adult Nobeautifulevenorgasmorgasmsporndoesfemalecameranomineeawardintimateangelsquirtingreleaseavn awardsquirtaward nomineedirectorelegant angelgoddessflowermalemoviesviewclosefans http://www.iphods.com/movie/492/busty-alexis-silver-36g/ http://www.iphods.com/videos/f80d7df45e47323d6d8e670d9310b06a.m4v http://www.iphods.com/clips/thumbs/f80d7df45e47323d6d8e670d9310b06a.jpg Busty Alexis Silver 36G Direct from our studio in California, CUMS our first volume of Alexis Silver, our busty slut with 36 G's. She is another young and busty, super horny babe just for you! Sit back and relax as our new honey entertain you. Watch Alexis Silver's best sex scenes ever... including her first hardcore anal scene ever recorded! 3 7 2009-08-21 Mature Adult Noyounghornyhardcorecumsbustyhardcore analsex scene http://www.iphods.com/movie/531/little-midget-big-dicks-2/ http://www.iphods.com/videos/6751fe0b8750dc12d1ba9d0864396944.m4v http://www.iphods.com/clips/thumbs/6751fe0b8750dc12d1ba9d0864396944.jpg Little Midget Big Dicks #2 Can she take it? You bet she can! This horny little lady just loves great big cocks! Midget gets it on with some of the biggest dicks in town. You would think their half pint size just wouldn't fit so much dick, but you would be wrong they crave it and take every inch! 3 7 2009-08-08 Mature Adult Nodickcockslovesladydicksbiggest http://www.iphods.com/movie/541/whorelore-season-1-episode-04-man-hunt/ http://www.iphods.com/videos/5728cd985669f33246ce060722401e3d.m4v http://www.iphods.com/clips/thumbs/5728cd985669f33246ce060722401e3d.jpg WhoreLore Season 1: Episode 04 - Man Hunt In "Man Hunt", Episode 4 of the WhoreLore series, the guild master Titus is captured and tortured by an evil gang of thugs. Held in a heavily guarded woodland camp, our heroes must save him before it is too late. Our Hunter calls on her feral companion to aid her in the rescue. 3.5 7 2009-08-08 Mature Adult Nomastertorturecallcamp http://www.iphods.com/movie/542/teenage-anal-eruptions/ http://www.iphods.com/videos/b95b3399c877664d52c84a3637cce9b7.m4v http://www.iphods.com/clips/thumbs/b95b3399c877664d52c84a3637cce9b7.jpg Teenage Anal Eruptions As if their fresh pussies weren't tight enough, these fresh young sluts spread open their virgin assholes for first time cum floods! Includes only the raunchiest taboo loops, including: Devil Cult: A black magic ritual turns a tiny virgin into an anal craving whore! Park Lovers: John Holmes takes a sweet young thing on a field trip to the zoo before jamming all 12" of cock up her rectum! Includes the absolute classic Tawny Pearl roller skating loop and more! 4.5 7 2009-08-08 Mature Adult Noloveyoungtightanalblackslutspussiesslutholesassholesincludescravingclassicfirst timeassholeloversloverspread http://www.iphods.com/movie/546/taboo-charming-mother-vol-6-immoral-tears/ http://www.iphods.com/videos/d932b43caa0aaa2e4d75e2379385724a.m4v http://www.iphods.com/clips/thumbs/d932b43caa0aaa2e4d75e2379385724a.jpg Taboo Charming Mother Vol. 6 - Immoral Tears 2009 AVN Award Nominee for Best Animated Release Kazuhiko continues the sexual rendezvous with his stepmother's sister, his aunt Emiko. Now his stepmother Misako's jealousy grows by the second. She soon realizes that she no longer needs her husband Yosuke. Instead, the one she truly desires both mentally and physically is Kazuhiko, however she only has a few days to make a decision whether to be his lover or go back to being a normal family.This movie is featured in the original Japanese with English subtitles. 5 7 2009-08-01 Mature Adult Nonomineeawardsecondhusbandreleasejapaneseavn awardaward nomineefeaturedcontinuesloverfeatureoriginaltruly http://www.iphods.com/movie/4/rick-savage-slave-training-101-tit-torture-caning/ http://www.iphods.com/videos/5594615dbe688f684964f702794339dd.m4v http://www.iphods.com/clips/thumbs/5594615dbe688f684964f702794339dd.jpg Rick Savage Slave Training 101: Tit Torture and Caning Pretty bondage virgin, Giselle, a country girl from Canada (by way of Minnesota) has entrusted her cherubic body to the wicked Master Savage for her first voyage into the world of bondage and discipline. Her slave training begins with the simple command, "Pick up your skirt and show me your ass." She obeys, and the camera views a set of meaty buttocks ideal for caning. A good spanking, paddling and caning will definitely be part of Giselle's slave training today. She obediently strips off her skirt and blouse. She is collared, a leash attached and she is taken for a walk around the dungeon. She obeys all commands, demonstrating the potential to become a good slave. Affixed to the St. Andrews cross, she receives her first taste of flogging on her back and succulent tush. Her little squeals of pain are music to the ears of any sadist. Savage commands her to push her butt out to receive punishment from his heavy leather flogger. She obeys and shortly her ass cheeks are a nice shade of glowing pink, in 5 6 2009-07-08 Mature Adult Nopussylovespankingtitsbondagebeautifulpunishmentboundpainslavehandsleatherbodynicecaningdeepmasterfinallyprettytorturecamerabuttlovestrainingropeshortfingerusedbarepaddleheavy,release,submission,pulls,dungeon,fingers,breasts,vibrator,boobs,clothes,ball,nipple,extreme,view,taken,decide,truly,music http://www.iphods.com/movie/216/aubrey-taylor-pantyhose-2/ http://www.iphods.com/videos/3f975d2afcb0b22b440688a1d4ecd746.m4v http://www.iphods.com/clips/thumbs/3f975d2afcb0b22b440688a1d4ecd746.jpg Aubrey Taylor Pantyhose #2 4 Scenes from this Living Doll in Pantyhose who Loves to Tease! Alone POV! Wolford's! Point and Cum! Secretary Role Play Games! Shiny Tights! Sneaky Voyeur Peeks! Real Life Instructions! "Sorry, but you can fuck your hand for me" Lots of Nice with some Naughty Talk from this Tight Bodied All Star Tease!!! Playtime sweetheart, Aubrey Taylor, gives you hot views of her shapely legs in black Wolford, sheer crotch pantyhose under her short black dress. She stands directly over you as you see her round ass and trimmed snatch through the nylon. She pumps her fist lightly and asks "do you want to come on my ass?" She raises her dress up over her hips and places her sweet feet under your nose. "Do you want to fuck them?" Dress and black bra off, she squeezes her perfect tits as she holds the cameras she pans her lean body and rubs her nylon covered mound as she's getting hot teasing you. Now, she'll entice you to jack off with great up shots as she peels the hose off. Next, in a short pleated skirt, blouse and nu 2.5 6 2009-02-19 Mature Adult Nopussylovetitsdickbodynicewhitefeettonguelifelegsyour cockcameralovesnaughtycrotchsecretcuteshortcoveredalonegameslipsteasingpullsshoespumpspreadpantyhoseviewslowly,close,inches,nylon http://www.iphods.com/movie/273/chelsea-spanks-cherry-clare/ http://www.iphods.com/videos/92897f2cf4eaf0364e86698d69a247ff.m4v http://www.iphods.com/clips/thumbs/92897f2cf4eaf0364e86698d69a247ff.jpg Chelsea Spanks: Cherry and Clare This video begins with a good old fashioned spanking for buoyant brunette, Cherry. Her figure may be gamine, but it still allows for a beautifully rounded rear. She fills the CS requirement perfectly. She is utterly, completely spankable! Chelsea had spanked Cherry once before, in "She Actually Spanks You!" (CP-100), so she knew her spankee's limits already. It just so happens, Cherry can take just about anything Chelsea can dish out and she gave Chelsea's arm a pretty good workout! Chelsea began by spanking Cherry over her jeans, but quickly required the assistance of a hairbrush. Those jeans had to come down pretty quickly, whereupon Chelsea went back to hand spanking, but only briefly. The hairbrush came out again in short order. Finally, a large wooden paddle was needed. Cherry must have been really naughty! By the look of her righteously reddened rear, she got just what she deserved. The second spankee, since there are always two in a CS video, is Chelsea's own, real-life good friend, Clare Fonda. Now, 4.5 6 2009-01-09 Mature Adult Nospankingfinallyvideoblackprettyanythinglifespankedcameranightdoorspanksbrunettenaughtyalwaysshortsecondhairpaddlecoveredstorychelsea'shairbrushcompletelyshootcompletepaddledlarge100%apartment http://www.iphods.com/movie/521/body-builders-in-heat/ http://www.iphods.com/videos/3f4dda60a6768105e00d76025336f392.m4v http://www.iphods.com/clips/thumbs/3f4dda60a6768105e00d76025336f392.jpg Body Builders In Heat Watch these buff babes power fuck and suck! They pump iron all day and pump cock all night! See these buff beauties unleash the raw muscle and powerful pussy that will claim any man's cock! You better be prepared to give them what they want, or they might just body-slam you!! 3 6 2009-08-14 Mature Adult Nocockbodynightpumppower http://www.iphods.com/movie/530/pornolympics-the-anal-games/ http://www.iphods.com/videos/110a481263b618bd6f39077228067d11.m4v http://www.iphods.com/clips/thumbs/110a481263b618bd6f39077228067d11.jpg Pornolympics: The Anal Games 2009 AVN Award Nominee for Best Director Foreign Non-Feature and Best Foreign All Sex Release The important thing isn't to win but to FUCK! These are the horniest games ever! Includes orgies, DPs, lesbians, dildo and ass fucking with 22 sluts battling for gold in the world championship of fucking! This is definitely not the "Special Olympics"; it's the PORNOLYMPICS! The only Olympic games where everyone walks away with a "PRIZE," including the pretty Asian commentator. She took home a "gold star" for being a good sport in the bukkake game! 4.5 6 2009-08-11 Mature Adult Nolesbianfuckingveryslutsprettypornlesbiansslutdildonomineeawardasianincludesgamesreleaseavn awardaward nomineedirectorfeaturebest director http://www.iphods.com/movie/536/teenage-brotha-lovers-9/ http://www.iphods.com/videos/2f07fb443babd7f33cad0d46748a147f.m4v http://www.iphods.com/clips/thumbs/2f07fb443babd7f33cad0d46748a147f.jpg Teenage Brotha Lovers 9 Barely legal cuties, fresh out of high school, love that big black meat! They want to walk on the dark side and they get the toughest of meat... black meat! Full and ready to pound these little cuties until they explode all over there faces! It's all about the young chicks! 3 6 2009-08-08 Mature Adult Noloveschoolblackchickshighbaredarkchickfacesbig black http://www.iphods.com/movie/4/rick-savage-slave-training-101-tit-torture-caning/ http://www.iphods.com/videos/95ed25f2ee49b60af1934b0da684fb24.m4v http://www.iphods.com/clips/thumbs/95ed25f2ee49b60af1934b0da684fb24.jpg Rick Savage Slave Training 101: Tit Torture and Caning Pretty bondage virgin, Giselle, a country girl from Canada (by way of Minnesota) has entrusted her cherubic body to the wicked Master Savage for her first voyage into the world of bondage and discipline. Her slave training begins with the simple command, "Pick up your skirt and show me your ass." She obeys, and the camera views a set of meaty buttocks ideal for caning. A good spanking, paddling and caning will definitely be part of Giselle's slave training today. She obediently strips off her skirt and blouse. She is collared, a leash attached and she is taken for a walk around the dungeon. She obeys all commands, demonstrating the potential to become a good slave. Affixed to the St. Andrews cross, she receives her first taste of flogging on her back and succulent tush. Her little squeals of pain are music to the ears of any sadist. Savage commands her to push her butt out to receive punishment from his heavy leather flogger. She obeys and shortly her ass cheeks are a nice shade of glowing pink, in 3.5 5 2009-07-08 Mature Adult Nopussylovespankingtitsbondagebeautifulpunishmentboundpainslavehandsleatherbodynicecaningdeepmasterfinallyprettytorturecamerabuttlovestrainingropeshortfingerusedbarepaddleheavy,release,submission,pulls,dungeon,fingers,breasts,vibrator,boobs,clothes,ball,nipple,extreme,view,taken,decide,truly,music http://www.iphods.com/movie/4/rick-savage-slave-training-101-tit-torture-caning/ http://www.iphods.com/videos/253585703f76e6b3c220e0a3aa8d9b08.m4v http://www.iphods.com/clips/thumbs/253585703f76e6b3c220e0a3aa8d9b08.jpg Rick Savage Slave Training 101: Tit Torture and Caning Pretty bondage virgin, Giselle, a country girl from Canada (by way of Minnesota) has entrusted her cherubic body to the wicked Master Savage for her first voyage into the world of bondage and discipline. Her slave training begins with the simple command, "Pick up your skirt and show me your ass." She obeys, and the camera views a set of meaty buttocks ideal for caning. A good spanking, paddling and caning will definitely be part of Giselle's slave training today. She obediently strips off her skirt and blouse. She is collared, a leash attached and she is taken for a walk around the dungeon. She obeys all commands, demonstrating the potential to become a good slave. Affixed to the St. Andrews cross, she receives her first taste of flogging on her back and succulent tush. Her little squeals of pain are music to the ears of any sadist. Savage commands her to push her butt out to receive punishment from his heavy leather flogger. She obeys and shortly her ass cheeks are a nice shade of glowing pink, in 3.5 5 2009-07-08 Mature Adult Nopussylovespankingtitsbondagebeautifulpunishmentboundpainslavehandsleatherbodynicecaningdeepmasterfinallyprettytorturecamerabuttlovestrainingropeshortfingerusedbarepaddleheavy,release,submission,pulls,dungeon,fingers,breasts,vibrator,boobs,clothes,ball,nipple,extreme,view,taken,decide,truly,music http://www.iphods.com/movie/55/freaky-black-azz/ http://www.iphods.com/videos/070373525d924b7873bcf6f1e5e370dc.m4v http://www.iphods.com/clips/thumbs/070373525d924b7873bcf6f1e5e370dc.jpg Freaky Black Azz The freaky black azzes aren't limited to only the nubile young nymphets featured herein. These hot, chocolate-brown studs are packing a bit of junk in their own trunks. But who cares--as long as they're packing a thick hot rod with all pistons firing under the hood! Come; take vicarious pleasure as we watch these huge phat asses with natural black breasts pour on the charm with their equally horny male pursuers. This movie is only 2 hours, not 4 hours like box cover indicates. 2.5 5 2009-06-04 Mature Adult Noyoungpleasurestudsblackthickhugenaturalchocolateassesfeaturedbreastsfeaturemale http://www.iphods.com/movie/271/spankorama/ http://www.iphods.com/videos/e7ec50e614e898727d240d53e41639d6.m4v http://www.iphods.com/clips/thumbs/e7ec50e614e898727d240d53e41639d6.jpg Spankorama In "Spankorama" the stories run continuously and in all the full beauty of the original digital recording. So, now, you can see the perfect, clear picture and hear the clean audio you've come to expect with our spanking movies. Even if you have already seen these clips on our members' site you'll enjoy revisiting them in their full rosy glory. The first story is entertains with a little holiday fun: Ashley Fires is an impish elf who ties-up, the stuffed animal Christmas toys she's supposed to wrap-up to load on Santa's sleigh. When Mrs. Claus catches Ashley in her naughty elf mischief, she delivers a Christmas Eve spanking the little elf won't soon forget! Story 2, also featuring Ashley, is a sensual tale of erotic spanking play between the sizzling, sexy blonde and Chelsea. Enticingly dressed in exquisite lingerie, Ashley is not shy concerning her exhibitionist tendencies! Ashley and Chelsea have a delicious sexual chemistry, as seen in the scenes they've done together. This was the first discovery of th 4.5 5 2009-01-09 Mature Adult Nolovespankingsexybeautifulpunishmentmistresssexualwomenplayblondedoesspankedbottombehindjulieerotictoysnaughtyeyessecretashleyofficesteamypaddlestorycleanlipschelsea'sstephanielingerielovely,movies,original,decide,paddled,stuffed,severe http://www.iphods.com/movie/274/soccer-moms-spank-off/ http://www.iphods.com/videos/7321281911caebe70b7902b5dc562967.m4v http://www.iphods.com/clips/thumbs/7321281911caebe70b7902b5dc562967.jpg Soccer Mom's Spank Off This is the second video featuring web mistress, Clare Fonda and Chelsea Pfeiffer Now, the kid gloves are off! This is a much more aggressive video all around. One spankee even cries real tears while the other is left with a visibly bruised bottom! Maggie Brown (Clare Fonda) visits Lana White (Chelsea Pfeiffer) hoping she can "persuade" Lana to take her son out of the running for a soccer scholarship. But Lana thinks Maggie's proposal is perfectly unethical and outrageous: In the interest of sportsmanship and fair play, Lana tries to spank the badness out of Maggie Brown! In the second scene, Maggie Brown, having endured a long hard spanking, with hand and hairbrush, is threatening to tell all the other soccer moms about the treatment she's received at the hand of Mrs. White. Considering the possible ramifications, Lana decides to allow Maggie to spank her in return for Maggie keeping her big mouth shut! And so, Maggie spanks Lana with all her might in revenge for the burning spanking she has just received 5 5 2009-01-09 Mature Adult Nospankingmistressvideoevenplaywhitemouthbottomspankslovessecondhairhairbrushmomsdeciderevenge http://www.iphods.com/movie/469/1st-time-black-amateurs-5/ http://www.iphods.com/videos/ddf5e544e281fa511d6af065465c8605.m4v http://www.iphods.com/clips/thumbs/ddf5e544e281fa511d6af065465c8605.jpg 1st Time Black Amateurs 5 Here is the freshest black beauties you can see anywhere! This set of beginners is so proper. Beautiful Sole is so pretty and smooth skinned! Nina has got the bombest pussy ever and a big fat ass... and she's pretty, pretty! Devin is a brand new sexy thing from Arizona! Plus more! 4.5 5 2009-08-28 Mature Adult Nopussybeautifulblackprettyropeskinnina http://www.iphods.com/movie/469/1st-time-black-amateurs-5/ http://www.iphods.com/videos/e64b097fa02ee9bd2a01e45a38528735.m4v http://www.iphods.com/clips/thumbs/e64b097fa02ee9bd2a01e45a38528735.jpg 1st Time Black Amateurs 5 Here is the freshest black beauties you can see anywhere! This set of beginners is so proper. Beautiful Sole is so pretty and smooth skinned! Nina has got the bombest pussy ever and a big fat ass... and she's pretty, pretty! Devin is a brand new sexy thing from Arizona! Plus more! 5 5 2009-08-28 Mature Adult Nopussybeautifulblackprettyropeskinnina http://www.iphods.com/movie/511/international-she-males-2-ride-my-giant-cock/ http://www.iphods.com/videos/349451738f6c228536e5a7e9e5bcc245.m4v http://www.iphods.com/clips/thumbs/349451738f6c228536e5a7e9e5bcc245.jpg International She-Males #2 - Ride My Giant Cock WOW!! Five hours of nothing but transsexual action! Men getting fucked by chicks with dicks! She-males sticking their cocks inside of men...and women! All scenes vary in locale; out by the pool or in the bedroom, there's plenty of mutual cock sucking and a ton of anal! 3.5 5 2009-08-15 Mature Adult Nodicksuckingsexualwomensuckcockschicksbedroomchickdickspoolmale http://www.iphods.com/movie/514/hung-honeys/ http://www.iphods.com/videos/afc1602564d8adc432fc8a9615d84f04.m4v http://www.iphods.com/clips/thumbs/afc1602564d8adc432fc8a9615d84f04.jpg Hung Honeys They're gorgeous, sweet and feminine in every way...except for one thing! Have a little something extra attached to them that they can play with. What's great about her is that she loves to be fucked in the ass, and she will get you one hell of a blowjob or even a hand job because she knows instinctively what a man would like. 4 5 2009-08-14 Mature Adult Noveryplayhelllovesextrablow http://www.iphods.com/movie/531/little-midget-big-dicks-2/ http://www.iphods.com/videos/ebd122355dcbcbc24e32017ecfc8ff27.m4v http://www.iphods.com/clips/thumbs/ebd122355dcbcbc24e32017ecfc8ff27.jpg Little Midget Big Dicks #2 Can she take it? You bet she can! This horny little lady just loves great big cocks! Midget gets it on with some of the biggest dicks in town. You would think their half pint size just wouldn't fit so much dick, but you would be wrong they crave it and take every inch! 5 5 2009-08-08 Mature Adult Nodickcockslovesladydicksbiggest http://www.iphods.com/movie/598/sindee-jones-is-supersquirt/ http://www.iphods.com/videos/f750de16bd5d4a42e5552c69c73f5c9c.m4v http://www.iphods.com/clips/thumbs/f750de16bd5d4a42e5552c69c73f5c9c.jpg Sindee Jones is Supersquirt 2009 AVN Award Nominee for Best Squirting ReleaseGet your slickers ready! Elegant Angel's hit series, Supersquirt, returns starring the insatiable Sindee Jennings, the newly crowned princess of orgasmic squirt eruptions.William H. has directed five scenes of face splashing, tit drenching, ass dousing, soaking wet debauchery. The torrential downpour of orgasmic fluids also stars Jenna Presley, Annie Cruz, Britney Stevenes, Chelsie Rae, and Flower Tucci. 5 5 2009-07-08 Mature Adult Nonomineeawardangelsquirtinginsatiablesquirtaward nomineeelegant angelflower http://www.iphods.com/movie/271/spankorama/ http://www.iphods.com/videos/0bb251fb9732fe3cc20455a773c68390.m4v http://www.iphods.com/clips/thumbs/0bb251fb9732fe3cc20455a773c68390.jpg Spankorama In "Spankorama" the stories run continuously and in all the full beauty of the original digital recording. So, now, you can see the perfect, clear picture and hear the clean audio you've come to expect with our spanking movies. Even if you have already seen these clips on our members' site you'll enjoy revisiting them in their full rosy glory. The first story is entertains with a little holiday fun: Ashley Fires is an impish elf who ties-up, the stuffed animal Christmas toys she's supposed to wrap-up to load on Santa's sleigh. When Mrs. Claus catches Ashley in her naughty elf mischief, she delivers a Christmas Eve spanking the little elf won't soon forget! Story 2, also featuring Ashley, is a sensual tale of erotic spanking play between the sizzling, sexy blonde and Chelsea. Enticingly dressed in exquisite lingerie, Ashley is not shy concerning her exhibitionist tendencies! Ashley and Chelsea have a delicious sexual chemistry, as seen in the scenes they've done together. This was the first discovery of th 3.5 4 2009-01-09 Mature Adult Nolovespankingsexybeautifulpunishmentmistresssexualwomenplayblondedoesspankedbottombehindjulieerotictoysnaughtyeyessecretashleyofficesteamypaddlestorycleanlipschelsea'sstephanielingerielovely,movies,original,decide,paddled,stuffed,severe http://www.iphods.com/movie/271/spankorama/ http://www.iphods.com/videos/3ab2980d5c939b1cb144436b69747352.m4v http://www.iphods.com/clips/thumbs/3ab2980d5c939b1cb144436b69747352.jpg Spankorama In "Spankorama" the stories run continuously and in all the full beauty of the original digital recording. So, now, you can see the perfect, clear picture and hear the clean audio you've come to expect with our spanking movies. Even if you have already seen these clips on our members' site you'll enjoy revisiting them in their full rosy glory. The first story is entertains with a little holiday fun: Ashley Fires is an impish elf who ties-up, the stuffed animal Christmas toys she's supposed to wrap-up to load on Santa's sleigh. When Mrs. Claus catches Ashley in her naughty elf mischief, she delivers a Christmas Eve spanking the little elf won't soon forget! Story 2, also featuring Ashley, is a sensual tale of erotic spanking play between the sizzling, sexy blonde and Chelsea. Enticingly dressed in exquisite lingerie, Ashley is not shy concerning her exhibitionist tendencies! Ashley and Chelsea have a delicious sexual chemistry, as seen in the scenes they've done together. This was the first discovery of th 4 4 2009-01-09 Mature Adult Nolovespankingsexybeautifulpunishmentmistresssexualwomenplayblondedoesspankedbottombehindjulieerotictoysnaughtyeyessecretashleyofficesteamypaddlestorycleanlipschelsea'sstephanielingerielovely,movies,original,decide,paddled,stuffed,severe http://www.iphods.com/movie/274/soccer-moms-spank-off/ http://www.iphods.com/videos/89a738afa30475968b32d47f5bdb01ee.m4v http://www.iphods.com/clips/thumbs/89a738afa30475968b32d47f5bdb01ee.jpg Soccer Mom's Spank Off This is the second video featuring web mistress, Clare Fonda and Chelsea Pfeiffer Now, the kid gloves are off! This is a much more aggressive video all around. One spankee even cries real tears while the other is left with a visibly bruised bottom! Maggie Brown (Clare Fonda) visits Lana White (Chelsea Pfeiffer) hoping she can "persuade" Lana to take her son out of the running for a soccer scholarship. But Lana thinks Maggie's proposal is perfectly unethical and outrageous: In the interest of sportsmanship and fair play, Lana tries to spank the badness out of Maggie Brown! In the second scene, Maggie Brown, having endured a long hard spanking, with hand and hairbrush, is threatening to tell all the other soccer moms about the treatment she's received at the hand of Mrs. White. Considering the possible ramifications, Lana decides to allow Maggie to spank her in return for Maggie keeping her big mouth shut! And so, Maggie spanks Lana with all her might in revenge for the burning spanking she has just received 3 4 2009-01-09 Mature Adult Nospankingmistressvideoevenplaywhitemouthbottomspankslovessecondhairhairbrushmomsdeciderevenge http://www.iphods.com/movie/274/soccer-moms-spank-off/ http://www.iphods.com/videos/bfc0e1c248039dfc91e84af68e0b3695.m4v http://www.iphods.com/clips/thumbs/bfc0e1c248039dfc91e84af68e0b3695.jpg Soccer Mom's Spank Off This is the second video featuring web mistress, Clare Fonda and Chelsea Pfeiffer Now, the kid gloves are off! This is a much more aggressive video all around. One spankee even cries real tears while the other is left with a visibly bruised bottom! Maggie Brown (Clare Fonda) visits Lana White (Chelsea Pfeiffer) hoping she can "persuade" Lana to take her son out of the running for a soccer scholarship. But Lana thinks Maggie's proposal is perfectly unethical and outrageous: In the interest of sportsmanship and fair play, Lana tries to spank the badness out of Maggie Brown! In the second scene, Maggie Brown, having endured a long hard spanking, with hand and hairbrush, is threatening to tell all the other soccer moms about the treatment she's received at the hand of Mrs. White. Considering the possible ramifications, Lana decides to allow Maggie to spank her in return for Maggie keeping her big mouth shut! And so, Maggie spanks Lana with all her might in revenge for the burning spanking she has just received 4.5 4 2009-01-09 Mature Adult Nospankingmistressvideoevenplaywhitemouthbottomspankslovessecondhairhairbrushmomsdeciderevenge http://www.iphods.com/movie/462/my-first-black-cock-7-milf-edition/ http://www.iphods.com/videos/125b5aaf25bdec61c0ef302af6a652e3.m4v http://www.iphods.com/clips/thumbs/125b5aaf25bdec61c0ef302af6a652e3.jpg My First Black Cock 7 - MILF Edition I was watching a really hot porn DVD with this hot Black guy and his huge cock fucking every chick in sight! I'd never seen anything that big, or that stayed so hard for so long. I had to try it. So I did! Girls, until you've had a massive Black rod up your pussy or your ass- you ain't had nothin' yet. And those Black studs really love us moms, we love to fuck and so do they. So I waited a long time for my first Black cock, but it was worth it... every time my old man goes on a business trip, I go on a 'Black cock' trip! Once you try it, you'll be Black Cockin' for good... and that's real good! 5 4 2009-09-03 Mature Adult Nopussyfuckingstudsverypornanythinghugemassivechickmomsbusiness http://www.iphods.com/movie/464/fuck-mom-me-4/ http://www.iphods.com/videos/120b77ddf840e5aa75df9de120cbf201.m4v http://www.iphods.com/clips/thumbs/120b77ddf840e5aa75df9de120cbf201.jpg Fuck Mom Me 4 Watch mother and daughter slurp on the same big cock! See how their pussies are similar in looks and taste! Audrianna wasn't happy with her boyfriend's little cock, so she came with her mom Kristina to Porn Valley to make some quick cash and to fuck some big dicks! Marie didn't inherit her mom Darryl's huge clit but don't worry, she got her Grandma's perky tits and tight snatch! Kendra and Bailey agree that nothing makes a cock taste better than the sweet flavor of a family member's pussy! Cameron was nervous about having a tongue jammed up her ass for the first time, so she brought her depraved whore of a mother Victoria along for moral support. 4 4 2009-09-02 Mature Adult Nocockpussytitstightpornpussiestongueboyfriendhugeoralfirst timehappydicksdaughterkrisclit http://www.iphods.com/movie/464/fuck-mom-me-4/ http://www.iphods.com/videos/3fcb4b8d73baeaae0e87fda2bcc4096f.m4v http://www.iphods.com/clips/thumbs/3fcb4b8d73baeaae0e87fda2bcc4096f.jpg Fuck Mom Me 4 Watch mother and daughter slurp on the same big cock! See how their pussies are similar in looks and taste! Audrianna wasn't happy with her boyfriend's little cock, so she came with her mom Kristina to Porn Valley to make some quick cash and to fuck some big dicks! Marie didn't inherit her mom Darryl's huge clit but don't worry, she got her Grandma's perky tits and tight snatch! Kendra and Bailey agree that nothing makes a cock taste better than the sweet flavor of a family member's pussy! Cameron was nervous about having a tongue jammed up her ass for the first time, so she brought her depraved whore of a mother Victoria along for moral support. 2 4 2009-09-02 Mature Adult Nocockpussytitstightpornpussiestongueboyfriendhugeoralfirst timehappydicksdaughterkrisclit http://www.iphods.com/movie/466/house-of-ass-9/ http://www.iphods.com/videos/d44f3d2be7e5831048cb557827025f0e.m4v http://www.iphods.com/clips/thumbs/d44f3d2be7e5831048cb557827025f0e.jpg House Of Ass 9 Lord Byron invites you into HOUSE OF ASS #9 where some of the finest asses anywhere entice you to jerk yourself silly. These gals find themselves impaled on Tom's tireless c*ck in this all-anal ass slam from Tom Byron Pictures. Get a towel and ready! 2.5 4 2009-08-29 Mature Adult Noanalasses http://www.iphods.com/movie/466/house-of-ass-9/ http://www.iphods.com/videos/625718eb43ae877ba9801764b41eafa9.m4v http://www.iphods.com/clips/thumbs/625718eb43ae877ba9801764b41eafa9.jpg House Of Ass 9 Lord Byron invites you into HOUSE OF ASS #9 where some of the finest asses anywhere entice you to jerk yourself silly. These gals find themselves impaled on Tom's tireless c*ck in this all-anal ass slam from Tom Byron Pictures. Get a towel and ready! 4 4 2009-08-29 Mature Adult Noanalasses http://www.iphods.com/movie/469/1st-time-black-amateurs-5/ http://www.iphods.com/videos/a75f1bf768deb97d83983792fa21be88.m4v http://www.iphods.com/clips/thumbs/a75f1bf768deb97d83983792fa21be88.jpg 1st Time Black Amateurs 5 Here is the freshest black beauties you can see anywhere! This set of beginners is so proper. Beautiful Sole is so pretty and smooth skinned! Nina has got the bombest pussy ever and a big fat ass... and she's pretty, pretty! Devin is a brand new sexy thing from Arizona! Plus more! 3 4 2009-08-28 Mature Adult Nopussybeautifulblackprettyropeskinnina http://www.iphods.com/movie/489/office-sluts/ http://www.iphods.com/videos/bc8752ec0e9077cc6411cc00f85a519a.m4v http://www.iphods.com/clips/thumbs/bc8752ec0e9077cc6411cc00f85a519a.jpg Office Sluts These horny babes spend all day talking about their office sex fantasies. They get so turned on they are compelled to turn their fantasies into reality. Beautiful girls sucking their boss's cock in his office, reception, and everywhere else. Double penetration on a desk girls' tongues fucking girls' pussies, two-girl-one-guy group sex and girls covered in cum! 3.5 4 2009-08-26 Mature Adult Nogirlscockgirlfuckingsuckingdoublesuckpussiestonguegroupofficecoveredfantasiesbosspenetration http://www.iphods.com/movie/492/busty-alexis-silver-36g/ http://www.iphods.com/videos/2dd82c7099bada0ddd3d821092b09a7e.m4v http://www.iphods.com/clips/thumbs/2dd82c7099bada0ddd3d821092b09a7e.jpg Busty Alexis Silver 36G Direct from our studio in California, CUMS our first volume of Alexis Silver, our busty slut with 36 G's. She is another young and busty, super horny babe just for you! Sit back and relax as our new honey entertain you. Watch Alexis Silver's best sex scenes ever... including her first hardcore anal scene ever recorded! 2 4 2009-08-21 Mature Adult Noyounghornyhardcorecumsbustyhardcore analsex scene http://www.iphods.com/movie/509/the-personal-trainer-volume-1/ http://www.iphods.com/videos/663a10f86a54ef3e8a778f423283208a.m4v http://www.iphods.com/clips/thumbs/663a10f86a54ef3e8a778f423283208a.jpg The Personal Trainer Volume 1 One-on-one training, mature poontang stretched out, and white moms fucked deep! These ass-licking MILFS are ready for a carnal workout and are up to the task with this virile hung stud! The ideal exercising plan for anyone in the mood to sweat and expel other bodily fluids! 2 4 2009-08-15 Mature Adult Nowhitelickingtrainingmomsmilfmilfs http://www.iphods.com/movie/510/how-to-please-a-she-male/ http://www.iphods.com/videos/5148d7792cd8e0087d808d5a50cb4e76.m4v http://www.iphods.com/clips/thumbs/5148d7792cd8e0087d808d5a50cb4e76.jpg How To Please A She-Male In an oral only movie devoted to she-males, Joey Silvera continues his obsession with She Males, extending the theme from lines like Rogue Adventures. With 4 well hung black she males (Nefertiti, Aimee Lee, Mistress Mina, and Hottie Cox), a pair of Brazilian She Males (Andreia and Adriana), and 3 white she males, there is a little something for every fan of this popular niche. 3.5 4 2009-08-15 Mature Adult Nomistressveryblackwhiteoralcontinuesmalepopularpair http://www.iphods.com/movie/510/how-to-please-a-she-male/ http://www.iphods.com/videos/0d018eb4f4f87c2277eaae12767fef37.m4v http://www.iphods.com/clips/thumbs/0d018eb4f4f87c2277eaae12767fef37.jpg How To Please A She-Male In an oral only movie devoted to she-males, Joey Silvera continues his obsession with She Males, extending the theme from lines like Rogue Adventures. With 4 well hung black she males (Nefertiti, Aimee Lee, Mistress Mina, and Hottie Cox), a pair of Brazilian She Males (Andreia and Adriana), and 3 white she males, there is a little something for every fan of this popular niche. 2 4 2009-08-15 Mature Adult Nomistressveryblackwhiteoralcontinuesmalepopularpair http://www.iphods.com/movie/512/big-beautiful/ http://www.iphods.com/videos/dac3373669208d78658e3a89dff6c3a9.m4v http://www.iphods.com/clips/thumbs/dac3373669208d78658e3a89dff6c3a9.jpg Big and Beautiful Big is beautiful! Big Tits, Big Cocks, Big Fun! Sexy tranny Three-Some's, Anal Sex, Blowjobs, Fucking, and most important the Money Shot! Horny she males that love to please, giving you intense pleasure either on their back or on their knees! Pull your hard cock out her phat ass, and bust a hot sticky load all over those big, beautiful breasts! Everyone knows big is the best!! 3 4 2009-08-14 Mature Adult Notitsbeautifulfuckinghornypleasureveryanalcocksthreeintenseblowjobsblowhard cockbreastskneesmaletranny http://www.iphods.com/movie/512/big-beautiful/ http://www.iphods.com/videos/563f7e07a55608c11ba18345a3c39ba7.m4v http://www.iphods.com/clips/thumbs/563f7e07a55608c11ba18345a3c39ba7.jpg Big and Beautiful Big is beautiful! Big Tits, Big Cocks, Big Fun! Sexy tranny Three-Some's, Anal Sex, Blowjobs, Fucking, and most important the Money Shot! Horny she males that love to please, giving you intense pleasure either on their back or on their knees! Pull your hard cock out her phat ass, and bust a hot sticky load all over those big, beautiful breasts! Everyone knows big is the best!! 2.5 4 2009-08-14 Mature Adult Notitsbeautifulfuckinghornypleasureveryanalcocksthreeintenseblowjobsblowhard cockbreastskneesmaletranny http://www.iphods.com/movie/514/hung-honeys/ http://www.iphods.com/videos/40011998b89e818259212a67c87798ec.m4v http://www.iphods.com/clips/thumbs/40011998b89e818259212a67c87798ec.jpg Hung Honeys They're gorgeous, sweet and feminine in every way...except for one thing! Have a little something extra attached to them that they can play with. What's great about her is that she loves to be fucked in the ass, and she will get you one hell of a blowjob or even a hand job because she knows instinctively what a man would like. 3 4 2009-08-14 Mature Adult Noveryplayhelllovesextrablow http://www.iphods.com/movie/514/hung-honeys/ http://www.iphods.com/videos/895d97587a0bd9dfed41ac008c35ece4.m4v http://www.iphods.com/clips/thumbs/895d97587a0bd9dfed41ac008c35ece4.jpg Hung Honeys They're gorgeous, sweet and feminine in every way...except for one thing! Have a little something extra attached to them that they can play with. What's great about her is that she loves to be fucked in the ass, and she will get you one hell of a blowjob or even a hand job because she knows instinctively what a man would like. 2 4 2009-08-14 Mature Adult Noveryplayhelllovesextrablow http://www.iphods.com/movie/521/body-builders-in-heat/ http://www.iphods.com/videos/1e5c790cf0ee97c81f6f9aa358a4b694.m4v http://www.iphods.com/clips/thumbs/1e5c790cf0ee97c81f6f9aa358a4b694.jpg Body Builders In Heat Watch these buff babes power fuck and suck! They pump iron all day and pump cock all night! See these buff beauties unleash the raw muscle and powerful pussy that will claim any man's cock! You better be prepared to give them what they want, or they might just body-slam you!! 4 4 2009-08-14 Mature Adult Nocockbodynightpumppower http://www.iphods.com/movie/522/nasty-lesbian-lovers/ http://www.iphods.com/videos/2ffd3ae444ed55fe274d4fd33a37fda8.m4v http://www.iphods.com/clips/thumbs/2ffd3ae444ed55fe274d4fd33a37fda8.jpg Nasty Lesbian Lovers Watch this uncensored lesbian lust. No men allowed. See some of porn's HOTTEST pussy packing bitches. Watch as she rams her ass and her pussy cause she is just ripe for the fucking. These horny sluts are craving the sweet taste of dripping pussy. Warning: Watch at your own risk. 4.5 4 2009-08-14 Mature Adult Nolesbianhottestslutsporndrippingcravingbitches http://www.iphods.com/movie/522/nasty-lesbian-lovers/ http://www.iphods.com/videos/e7c717dd960dfa3ceb5d50ba66b3c7a8.m4v http://www.iphods.com/clips/thumbs/e7c717dd960dfa3ceb5d50ba66b3c7a8.jpg Nasty Lesbian Lovers Watch this uncensored lesbian lust. No men allowed. See some of porn's HOTTEST pussy packing bitches. Watch as she rams her ass and her pussy cause she is just ripe for the fucking. These horny sluts are craving the sweet taste of dripping pussy. Warning: Watch at your own risk. 3.5 4 2009-08-14 Mature Adult Nolesbianhottestslutsporndrippingcravingbitches http://www.iphods.com/movie/524/secretary-thing/ http://www.iphods.com/videos/9cb02a79538ca7ca128117d32fd4bcec.m4v http://www.iphods.com/clips/thumbs/9cb02a79538ca7ca128117d32fd4bcec.jpg Secretary Thing 2009 AVN Award Nominee for Best Vignette Release Special Note: This Is Movie # 100,000 In Our VOD Library!!! Patrick Collins proudly presents, It's A Secretary Thing, a collection of stunning superstars dressed up as seductive secretaries. Watch the curvaceous Shyla Stylez, alongside Jenaveve Jolie, Karlie Montana, Carli Banks, Ashley Blue, Evie Delatosso, and Jamie Lamore. It's a Secretary Thing is a depiction of fantasy role-playing at its best. In an industry that is over saturated with unoriginal couch sex, Patrick Collins focuses on creative scenarios, chemistry between performers and real female orgasms. His movies are unlike anything else in porn. 5 4 2009-08-13 Mature Adult Noplayorgasmspornfemalestylenomineesecretashleyfantasyreleaseavn awardaward nomineecollectioncarlicollinssuperstarmalemoviesoriginal100%blue http://www.iphods.com/movie/524/secretary-thing/ http://www.iphods.com/videos/a1acc1b4afd2873c6fd5f14bc0285327.m4v http://www.iphods.com/clips/thumbs/a1acc1b4afd2873c6fd5f14bc0285327.jpg Secretary Thing 2009 AVN Award Nominee for Best Vignette Release Special Note: This Is Movie # 100,000 In Our VOD Library!!! Patrick Collins proudly presents, It's A Secretary Thing, a collection of stunning superstars dressed up as seductive secretaries. Watch the curvaceous Shyla Stylez, alongside Jenaveve Jolie, Karlie Montana, Carli Banks, Ashley Blue, Evie Delatosso, and Jamie Lamore. It's a Secretary Thing is a depiction of fantasy role-playing at its best. In an industry that is over saturated with unoriginal couch sex, Patrick Collins focuses on creative scenarios, chemistry between performers and real female orgasms. His movies are unlike anything else in porn. 4 4 2009-08-13 Mature Adult Noplayorgasmspornfemalestylenomineesecretashleyfantasyreleaseavn awardaward nomineecollectioncarlicollinssuperstarmalemoviesoriginal100%blue http://www.iphods.com/movie/527/flower-squirt-shower-6/ http://www.iphods.com/videos/5f1ce2e39cfb50775cd0573f902600fc.m4v http://www.iphods.com/clips/thumbs/5f1ce2e39cfb50775cd0573f902600fc.jpg Flower Squirt Shower 6 2009 AVN Award Nominee for Best Squirting ReleaseThe AVN award winning series, Flower's Squirt Shower, returns with the sixth volume, starring the goddess of gush, porn super star Flower Tucci. Volume's 2 and 3 have both been recipient's of AVN editor's choice reviews, and at this year's AVN awards the series won for Best Specialty Release - Squirting. Squirt Shower 6 is bigger, better, and wetter than ever. Featuring a squirt drenched bevy of beautiful starlets including Jada Fire, Sindee Jennings, Britney Stevens, Nicki Hunter, and Gianna. While there are many imitators, Elegant Angel is the company that porn fans can rely upon for squirting movies that celebrate female orgasms with camera work that doesn't stay wide when you want it to get up close and intimate. Director William H.'s camera lens is once again squirt soaked, as Flower Tucci subjects us to a relentless onslaught of female ejaculation. 3.5 4 2009-08-12 Mature Adult Nobeautifulevenorgasmorgasmsporndoesfemalecameranomineeawardintimateangelsquirtingreleaseavn awardsquirtaward nomineedirectorelegant angelgoddessflowermalemoviesviewclosefans http://www.iphods.com/movie/532/my-aunt-likes-big-black-dicks/ http://www.iphods.com/videos/fba985d2907abf6a8524d08a55c9586f.m4v http://www.iphods.com/clips/thumbs/fba985d2907abf6a8524d08a55c9586f.jpg My Aunt Likes Big Black Dicks My aunt has discovered the joy of big black cocks! Now she just cannot get enough of those fine black brothers. Hotbox auntie takes on all the big, black studs! Long, Black, and juicy just drives these aunts wild! Cum and enjoy all the hot black on white action! 4.5 4 2009-08-08 Mature Adult Nocockwildstudscockswhitecoveredjuicybig black http://www.iphods.com/movie/532/my-aunt-likes-big-black-dicks/ http://www.iphods.com/videos/2d691e82eb983feb2839ea41a0e9978f.m4v http://www.iphods.com/clips/thumbs/2d691e82eb983feb2839ea41a0e9978f.jpg My Aunt Likes Big Black Dicks My aunt has discovered the joy of big black cocks! Now she just cannot get enough of those fine black brothers. Hotbox auntie takes on all the big, black studs! Long, Black, and juicy just drives these aunts wild! Cum and enjoy all the hot black on white action! 4 4 2009-08-08 Mature Adult Nocockwildstudscockswhitecoveredjuicybig black http://www.iphods.com/movie/548/oil-overload-disc-1/ http://www.iphods.com/videos/e8cb067d33823788ac1a0428fddfa76f.m4v http://www.iphods.com/clips/thumbs/e8cb067d33823788ac1a0428fddfa76f.jpg Oil Overload (Disc 1) 2009 AVN Award Nominee for Best Director Non-Feature and Best Gonzo ReleaseSuperstars lubed and cum-hungry for an overload of throbbing cocks! These slippery sluts are sliding all over the place getting ready to be fried in a batch of cum! Without a need for KY they can slide into anyone of their waiting holes and hungry faces. These girls love a messy fuck!! 5 4 2009-08-01 Mature Adult Nogirlslovegirlslutscocksslutholesnomineeawardreleaseavn awardaward nomineedirectorfacesfeaturesuperstarbest director http://www.iphods.com/movie/549/she-male-a-go-go/ http://www.iphods.com/videos/3656317a8b020b6d1c8fa97db117c760.m4v http://www.iphods.com/clips/thumbs/3656317a8b020b6d1c8fa97db117c760.jpg She-Male A Go-Go Well, you wouldn't expect it, but that bulge in her panties is not a swollen mound of vaginal pleasure. Instead, it's a cock. She's, I mean uh, well, I don't know exactly what I mean, but this is a hot orgy and you're invited. Are you ready to get your swerve on? 3 4 2009-08-01 Mature Adult Nocockpleasurepantiesorgy http://www.iphods.com/movie/550/love-honor-obey/ http://www.iphods.com/videos/4081cadd0a438f408fe001f626ef517d.m4v http://www.iphods.com/clips/thumbs/4081cadd0a438f408fe001f626ef517d.jpg Love, Honor and Obey Imagine if Lucy and Ricky were really in the scene and played hard. That is what you have with our Lydia and John. This scenario includes domestic discipline only, unobscured by kisses, caresses, sex or any other mushy stuff. On a severity scale, it's a nine and three quarters. It also has superb picture and sound quality, one of the prettiest couples we've ever featured with some of the livliest dialog ever. Fantastic spanking action abounds! 3.5 4 2009-08-01 Mature Adult Nospankingboundkissincludescouplesfeaturedcouplefeatureplayed http://www.iphods.com/movie/552/next-door-bi-encounter-vol-1/ http://www.iphods.com/videos/dee7fda0d5c8fbe42146ec9319aa1273.m4v http://www.iphods.com/clips/thumbs/dee7fda0d5c8fbe42146ec9319aa1273.jpg Next Door: Bi-Encounter Vol. 1 This is the one you have been waiting for! Next Door Studios releases its VERY FIRST Bi-Sexual DVD! Oh and did we mention that everybody's favorite Tyler Cummings is one of the main stars! This is your chance to see Tyler Cummings play with another man's cock, as well as has have his cock sucked and jerked by other hot guys, while engaged in some of the hottest Bi-Sexual action we have ever got on film! Six steamy scenes - sexy threesomes and even a foursome. 4.5 4 2009-08-01 Mature Adult Nohottestbodyfilmguyssuckplayfourthreedoorsteamyfavoriterelease http://www.iphods.com/movie/557/more-cushion-for-the-pushin-2/ http://www.iphods.com/videos/4029e85ff41671ba62abf71fea873e0d.m4v http://www.iphods.com/clips/thumbs/4029e85ff41671ba62abf71fea873e0d.jpg More Cushion For The Pushin' #2 Cassandra loves sucking dick and smothering guys with her ample ass! We oiled up naughty new comer Noels voluptuous body before we let Nick go to town on that ass! Ally Foster is a pretty young thing from Indiana with a great set of 38D yabos! 19 year-old blonde hottie Oklahoma wants you to eat her pussy and then fuck her hard! Victoria Vonn is a passionate tramp from Florida who is always thirsty for hard cock. If all natural curvaceous sluts make you horny , they you'll love more cushion for the pushin' #2. 5 4 2009-07-29 Mature Adult Nocockpussyyoungdicksuckingbodyhornyguyssuckslutsprettyblondeslutlovesnaturalnaughtyalwayshard cocksmotheringpassionatevoluptuous http://www.iphods.com/movie/557/more-cushion-for-the-pushin-2/ http://www.iphods.com/videos/8a92937e239c8954a560db71166f6b76.m4v http://www.iphods.com/clips/thumbs/8a92937e239c8954a560db71166f6b76.jpg More Cushion For The Pushin' #2 Cassandra loves sucking dick and smothering guys with her ample ass! We oiled up naughty new comer Noels voluptuous body before we let Nick go to town on that ass! Ally Foster is a pretty young thing from Indiana with a great set of 38D yabos! 19 year-old blonde hottie Oklahoma wants you to eat her pussy and then fuck her hard! Victoria Vonn is a passionate tramp from Florida who is always thirsty for hard cock. If all natural curvaceous sluts make you horny , they you'll love more cushion for the pushin' #2. 2.5 4 2009-07-29 Mature Adult Nocockpussyyoungdicksuckingbodyhornyguyssuckslutsprettyblondeslutlovesnaturalnaughtyalwayshard cocksmotheringpassionatevoluptuous http://www.iphods.com/movie/560/its-a-daddy-thing-4/ http://www.iphods.com/videos/859b6e73c379c6d49a809d4954f65cff.m4v http://www.iphods.com/clips/thumbs/859b6e73c379c6d49a809d4954f65cff.jpg It's A Daddy Thing! 4 2009 AVN Award Winner for Best Young Girl Series.Patrick Collins returns with another collection of prissy, cock teasing teens in Elegant Angel's It's a Daddy Thing 4. Alexis Love, Evie Delatosso, Nika, Naomi Cruise, and Nikki Flame star as filthy young flirtatious sluts, provocatively seducing older guys. The movie is a sexually sophisticated depiction of fantasy role-playing at its best. Elegant Angel is the porn company that customers can rely upon for a more creative brand of eroticism. 2.5 4 2009-07-24 Mature Adult Nococklovegirlguysplayslutspornsluteroticawardwinnerangelolderteasingfantasyavn awardcollectionelegant angelcollinssexuallyaward winnerfilthy http://www.iphods.com/movie/564/white-room-4/ http://www.iphods.com/videos/4ec0b91d50bcc9f14686bd50c470f981.m4v http://www.iphods.com/clips/thumbs/4ec0b91d50bcc9f14686bd50c470f981.jpg White Room 4 The WHITE ROOM series are probably the most successful fetish films of all times. As early as 1990, Part 1 was produced, followed by Part 2 in 1991, and Part 3 in 1996. Now - ten years after - the subterranean, clinical dungeon awakes to new pervy. Explicit as never before, bone hard fetish action on the antique operating table, mobile dildo-pole, bondage bags and balloon bodies, crutches, wheelchairs, dildos and strap-ons... Bizarre fetish-play on to the genuine climax! 4 4 2009-07-24 Mature Adult Nobondagefilmplaywhitefetishdildohairdungeonfilmsdildosbizarreballtable http://www.iphods.com/movie/560/its-a-daddy-thing-4/ http://www.iphods.com/videos/5b73d7c028b432925a066f5ac7755674.m4v http://www.iphods.com/clips/thumbs/5b73d7c028b432925a066f5ac7755674.jpg It's A Daddy Thing! 4 2009 AVN Award Winner for Best Young Girl Series.Patrick Collins returns with another collection of prissy, cock teasing teens in Elegant Angel's It's a Daddy Thing 4. Alexis Love, Evie Delatosso, Nika, Naomi Cruise, and Nikki Flame star as filthy young flirtatious sluts, provocatively seducing older guys. The movie is a sexually sophisticated depiction of fantasy role-playing at its best. Elegant Angel is the porn company that customers can rely upon for a more creative brand of eroticism. 2.5 4 2009-07-24 Mature Adult Nococklovegirlguysplayslutspornsluteroticawardwinnerangelolderteasingfantasyavn awardcollectionelegant angelcollinssexuallyaward winnerfilthy http://www.iphods.com/movie/742/butt-nurse-3/ http://www.iphods.com/videos/ed3725da25474ffaa675d27b5487e00f.m4v http://www.iphods.com/clips/thumbs/ed3725da25474ffaa675d27b5487e00f.jpg Butt Nurse 3 This time it's a house call. Once again this fellow is sick with tummy aches and the Dr. sent the nurses to help him out. It begins with a regular exam but when its time for a rectal temperature taking he decides to give the nurses a hard time. She warned him before this about a good spanking if he gave them a hard time. With out a word he is turned over, the nurse knees and gives him a hard bare bottom spanking until his bottom is bright red. Then his temperature is taken again. He is also given a rectal exam with one and 2 finger insertions. They find he is constipated so first he is given a castor oil enema. He once again gives the nurses a hard time. He is paddled this time with a large round wooden paddle. His bottom is then stretched and reamed open with inflatable butt plugs and dildos. When one nurse leaves the room the other decided she is going to teach this guy a lesson. She tells him he needs more anal lubricating and reaming. So she takes out a large strap-on dildo and gives him a reaming fucking 4.5 4 2009-04-17 Mature Adult Nospankingfuckingdeepanalbottombuttdildofingerbarepaddlecallenemalessonkneesdildosnursetakendecidepaddledlargeregulartableleaves http://www.iphods.com/movie/16/good-and-plenty/ http://www.iphods.com/videos/6eb60d63b73d0e26b35d16a27ab1afcb.m4v http://www.iphods.com/clips/thumbs/6eb60d63b73d0e26b35d16a27ab1afcb.jpg Good And Plenty Beautiful black babes (BBB) find themselves in the right place at the right time, invariably with a well-hung chocolate hunk somewhere nearby. Well now, that's lucky! The irresistible lure of these bodacious, bubbling blossoms is so powerful that these hot studs can't resist sampling their aromatic fruit. It has been said, the blacker the berry, the sweeter the juice. These sexy sistas get stuffed with stiff, hard, black cock as a result! 4 3 2009-07-01 Mature Adult Nosexybeautifulstudsblackchocolatepowerstuffedlucky http://www.iphods.com/movie/33/imperfect-angels-episode-5/ http://www.iphods.com/videos/ab24ced2fdf6d6b31d6a1313896bc080.m4v http://www.iphods.com/clips/thumbs/ab24ced2fdf6d6b31d6a1313896bc080.jpg Imperfect Angels Episode 5 "The Tangled Web of Fallen Doves" Samantha feels the heat and goes home for the weekend for a much needed rest, only to find out the heat turned up there, as well. Faye dreams of stepmom Maggie's steamy return, and Dana slowly seduces reluctant lesbian Lisa. Daisy continues her blackmail campaign when she exposes all matters to her friend Kurious. 3 3 2009-06-19 Mature Adult Nolesbiansteamycontinuesslowlycamp http://www.iphods.com/movie/33/imperfect-angels-episode-5/ http://www.iphods.com/videos/6ff72762edf044c56ff926096befd137.m4v http://www.iphods.com/clips/thumbs/6ff72762edf044c56ff926096befd137.jpg Imperfect Angels Episode 5 "The Tangled Web of Fallen Doves" Samantha feels the heat and goes home for the weekend for a much needed rest, only to find out the heat turned up there, as well. Faye dreams of stepmom Maggie's steamy return, and Dana slowly seduces reluctant lesbian Lisa. Daisy continues her blackmail campaign when she exposes all matters to her friend Kurious. 3 3 2009-06-19 Mature Adult Nolesbiansteamycontinuesslowlycamp http://www.iphods.com/movie/59/cuckold-fantasies-vol-12/ http://www.iphods.com/videos/0081d91f4a0a12e4634377139dfb50c9.m4v http://www.iphods.com/clips/thumbs/0081d91f4a0a12e4634377139dfb50c9.jpg Cuckold Fantasies Vol. 12 How much cum can one unlucky husband consume? Would you believe 5 GOOEY LOADS? Gorgeous blonde wife Holly Foxxx masturbates in up-close POV as she yearns for a BIG COCK to fill her neglected pussy. She tells you just how pathetic her worthless husband is and how tiny his dick is. She releases husband Jimmy from the under-the-stairs cubbyhole where he's forced to sleep, and makes him WORSHIP HER ASS AND PUSSY. She torments him and his CHASTITY DEVICE bound penis, before sending him off to work. While her wimpy husband is away, Holly invites studly lover Shane over for the afternoon. As they KISS deeply, she rips down his pants to reveal a MASSIVE ERECTION! She praises his cock as she runs her hands over it and finally takes it in her mouth. Husband Jimmy returns to find his wife giving this stranger a BLOWJOB. She orders him to undress and kiss her feet while she services this real man. Bewildered wuss that he is, Jimmy complies. He can only watch helplessly as Holly's mouth is stretched by this clearly sup 5 3 2009-06-04 Mature Adult Nopussytightboundpainhandsdickdeepforcedfinallyblondefeetmouthkisswifemassivehusbandblowreleasecontinuesloverhelplessballcloselucky http://www.iphods.com/movie/68/where-theres-smoke-ii-another-smoking-sex-fantasy/ http://www.iphods.com/videos/1e48baf71ba5818ac1abc0be16fcfa39.m4v http://www.iphods.com/clips/thumbs/1e48baf71ba5818ac1abc0be16fcfa39.jpg Where There's Smoke II - Another Smoking Sex Fantasy The queen of hardcore smoking sex fetish is back with another collection of brand new scenes that are sure to fuel your every addiction! No one nails the smoking sex fetish like Marie Madison!. Six brand new scenes including the smash VOD hit "The Ritual" available for the first time on DVD! 4.5 3 2009-05-29 Mature Adult Nohardcorefetishsmokingfirst timecollectionqueen http://www.iphods.com/movie/224/disciplining-betty/ http://www.iphods.com/videos/f7816cb668c2b1b7a0d8b8d643f96254.m4v http://www.iphods.com/clips/thumbs/f7816cb668c2b1b7a0d8b8d643f96254.jpg Disciplining Betty Razor wants Betty to get better grades in college, but she can't seem to focus on that. She agrees to submit to discipline to help her concentrate, before realizing exactly what that means to her boyfriend. Familiar with "fun and games" style spanking, the feel of a hard and disciplinary hand on her silky smooth bottom comes as something of a shock! Razor spanks Betty hard and scolds her roundly. But Betty is a modern girl who resents such condescending treatment and doesn't scruple to let him know this. (Since this is a spanking video, her protests are ignored. Don't try this at home - unless you're dating a fellow spanking enthusiast!) After a not very gentle warm up, Betty's classic straight skirt is lifted and she treated to a brisk panty warming, during which the disciplinarian boyfriend barely pauses to notice the elegance of her silk lingerie combination. In due course, the voluptuous coed is stripped down to her dainty matching bra and panty, heels and hose ensemble, to receive the full measure of 3.5 3 2009-02-17 Mature Adult Nospankingyoungpunishmenthandspartybodywomanfilmvideoevendoesfetishlifeboyfriendspankedbottomfriendsspanksbrunettestylehighnaturalalwaysbarelearnhairpaddlegamesoralolderlady,classic,razor,lingerie,heels,breasts,lover,feature,ends,girlfriend,complete,queen,position,voluptuous,stripped,videos,free http://www.iphods.com/movie/273/chelsea-spanks-cherry-clare/ http://www.iphods.com/videos/a105bec4c0e539a1cc73b5c6716b3e76.m4v http://www.iphods.com/clips/thumbs/a105bec4c0e539a1cc73b5c6716b3e76.jpg Chelsea Spanks: Cherry and Clare This video begins with a good old fashioned spanking for buoyant brunette, Cherry. Her figure may be gamine, but it still allows for a beautifully rounded rear. She fills the CS requirement perfectly. She is utterly, completely spankable! Chelsea had spanked Cherry once before, in "She Actually Spanks You!" (CP-100), so she knew her spankee's limits already. It just so happens, Cherry can take just about anything Chelsea can dish out and she gave Chelsea's arm a pretty good workout! Chelsea began by spanking Cherry over her jeans, but quickly required the assistance of a hairbrush. Those jeans had to come down pretty quickly, whereupon Chelsea went back to hand spanking, but only briefly. The hairbrush came out again in short order. Finally, a large wooden paddle was needed. Cherry must have been really naughty! By the look of her righteously reddened rear, she got just what she deserved. The second spankee, since there are always two in a CS video, is Chelsea's own, real-life good friend, Clare Fonda. Now, 2 3 2009-01-09 Mature Adult Nospankingfinallyvideoblackprettyanythinglifespankedcameranightdoorspanksbrunettenaughtyalwaysshortsecondhairpaddlecoveredstorychelsea'shairbrushcompletelyshootcompletepaddledlarge100%apartment http://www.iphods.com/movie/273/chelsea-spanks-cherry-clare/ http://www.iphods.com/videos/15446114a7223b6787f94adfbb0a9633.m4v http://www.iphods.com/clips/thumbs/15446114a7223b6787f94adfbb0a9633.jpg Chelsea Spanks: Cherry and Clare This video begins with a good old fashioned spanking for buoyant brunette, Cherry. Her figure may be gamine, but it still allows for a beautifully rounded rear. She fills the CS requirement perfectly. She is utterly, completely spankable! Chelsea had spanked Cherry once before, in "She Actually Spanks You!" (CP-100), so she knew her spankee's limits already. It just so happens, Cherry can take just about anything Chelsea can dish out and she gave Chelsea's arm a pretty good workout! Chelsea began by spanking Cherry over her jeans, but quickly required the assistance of a hairbrush. Those jeans had to come down pretty quickly, whereupon Chelsea went back to hand spanking, but only briefly. The hairbrush came out again in short order. Finally, a large wooden paddle was needed. Cherry must have been really naughty! By the look of her righteously reddened rear, she got just what she deserved. The second spankee, since there are always two in a CS video, is Chelsea's own, real-life good friend, Clare Fonda. Now, 3 3 2009-01-09 Mature Adult Nospankingfinallyvideoblackprettyanythinglifespankedcameranightdoorspanksbrunettenaughtyalwaysshortsecondhairpaddlecoveredstorychelsea'shairbrushcompletelyshootcompletepaddledlarge100%apartment http://www.iphods.com/movie/273/chelsea-spanks-cherry-clare/ http://www.iphods.com/videos/50b3f76d02a84497977cf0ddb0101d58.m4v http://www.iphods.com/clips/thumbs/50b3f76d02a84497977cf0ddb0101d58.jpg Chelsea Spanks: Cherry and Clare This video begins with a good old fashioned spanking for buoyant brunette, Cherry. Her figure may be gamine, but it still allows for a beautifully rounded rear. She fills the CS requirement perfectly. She is utterly, completely spankable! Chelsea had spanked Cherry once before, in "She Actually Spanks You!" (CP-100), so she knew her spankee's limits already. It just so happens, Cherry can take just about anything Chelsea can dish out and she gave Chelsea's arm a pretty good workout! Chelsea began by spanking Cherry over her jeans, but quickly required the assistance of a hairbrush. Those jeans had to come down pretty quickly, whereupon Chelsea went back to hand spanking, but only briefly. The hairbrush came out again in short order. Finally, a large wooden paddle was needed. Cherry must have been really naughty! By the look of her righteously reddened rear, she got just what she deserved. The second spankee, since there are always two in a CS video, is Chelsea's own, real-life good friend, Clare Fonda. Now, 3.5 3 2009-01-09 Mature Adult Nospankingfinallyvideoblackprettyanythinglifespankedcameranightdoorspanksbrunettenaughtyalwaysshortsecondhairpaddlecoveredstorychelsea'shairbrushcompletelyshootcompletepaddledlarge100%apartment http://www.iphods.com/movie/276/chelsea-spankskailee-berlin/ http://www.iphods.com/videos/e33b6ccb153db3459c7b8d2d673ae4a0.m4v http://www.iphods.com/clips/thumbs/e33b6ccb153db3459c7b8d2d673ae4a0.jpg Chelsea Spanks:Kailee and Berlin Kailee's Spanking: Kailee came to us while visiting friends here in Southern California. She's a former Real Spankings model and since they've stopped shooting new material, she's been getting her spanking fixes with the various other spanking production companies, ours included. And, lucky for us! A truly experienced and truly enthusiastic spanking aficionado, Kailee could take all that I could dish out and any of you familiar with my spanking style knows that's quite a bit! We started with a hand spanking, but soon moved on to the first of six implements. Even though I dish out a diabolical hand spanking, I recognized pretty quickly that Kailee was up for more...a LOT more! By the time her half hour spanking concluded, Kailee had been paddled with my leather paddle, spanked with a hairbrush, strapped with a black leather strap, paddled (again!) with a VERY large wooden paddle and finally caned with my little twisted cane. That little cane is a lot stingier than it looks! Berlin's Spanking: I don't oft 3 3 2009-01-09 Mature Adult Noyoungnastyleatherexperiencefinallyevenprettyspankedfriendsstyleberlinshortsurpriseangelusedhairpaddleexperiencedsmokehairbrushshootpaddledlargeluckytruly http://www.iphods.com/movie/321/intimate-moments/ http://www.iphods.com/videos/1bde4ebcdb99629a052e38e45753a534.m4v http://www.iphods.com/clips/thumbs/1bde4ebcdb99629a052e38e45753a534.jpg Intimate Moments Watch as each girl invites us in to witness one of the most intimate moments a person can experience - masturbation to orgasm. This is the real thing, no artifice, no fakery. Six girls, each alone in their rooms, no toys, doing it the only way they know how, their way, so that they can reach genuine orgasm. 4 3 2009-12-05 Mature Adult Noexperienceorgasmtoysintimatealonemasturbation http://www.iphods.com/movie/321/intimate-moments/ http://www.iphods.com/videos/25446e4494efaca6749d6a80e5843229.m4v http://www.iphods.com/clips/thumbs/25446e4494efaca6749d6a80e5843229.jpg Intimate Moments Watch as each girl invites us in to witness one of the most intimate moments a person can experience - masturbation to orgasm. This is the real thing, no artifice, no fakery. Six girls, each alone in their rooms, no toys, doing it the only way they know how, their way, so that they can reach genuine orgasm. 5 3 2009-12-05 Mature Adult Noexperienceorgasmtoysintimatealonemasturbation http://www.iphods.com/movie/432/bondage-lovers/ http://www.iphods.com/videos/0c28dc93be598098918dbe9b7e4e2341.m4v http://www.iphods.com/clips/thumbs/0c28dc93be598098918dbe9b7e4e2341.jpg Bondage Lovers Julie Simone's not happy unless someone is tied up and gagged! 5 on-screen tying scenes featuring the top names in bondage tied by the best rigger in the industry, Julie Simone. Allanah Rhodes looks adorable in white cotton socks and panties as she and Julie spend a romantic night at home, in ropes! Madison Young, in a corset, heels and stockings, is placed over Julie's knee for an OTK spanking, before getting tied up, tortured and played with. Her reward: several forced orgasms! Ashley Renee gets to experience being a room ornament, complete with breast clothespins, first-hand! Mary Jane learns that she loves bondage after all, after cat fighting and getting knocked out by Julie, getting tied up, being shoved with a violet wand, before Julie finally plays nice and lets her have several forced orgasms with a vibrator. Jewell Marceau, dressed in red latex, is treated to a severe one-legged suspension that has her balancing on one knee while her hair is tied up above her. Also, features a multi-layer gag! Nobo 3.5 3 2009-09-18 Mature Adult Nospankingyoungbondagebodyexperiencetiedniceforcedfinallyplayorgasmorgasmsdoeswhitetorturenightgaggedjulielovesropeashleylearnhairhappypantiesstockingsheelsvibratorjewelllatexfeature,clothes,played,complete,marceau,severe,jewell marceau http://www.iphods.com/movie/432/bondage-lovers/ http://www.iphods.com/videos/48ba9a169bc01b6b22118edbdae04467.m4v http://www.iphods.com/clips/thumbs/48ba9a169bc01b6b22118edbdae04467.jpg Bondage Lovers Julie Simone's not happy unless someone is tied up and gagged! 5 on-screen tying scenes featuring the top names in bondage tied by the best rigger in the industry, Julie Simone. Allanah Rhodes looks adorable in white cotton socks and panties as she and Julie spend a romantic night at home, in ropes! Madison Young, in a corset, heels and stockings, is placed over Julie's knee for an OTK spanking, before getting tied up, tortured and played with. Her reward: several forced orgasms! Ashley Renee gets to experience being a room ornament, complete with breast clothespins, first-hand! Mary Jane learns that she loves bondage after all, after cat fighting and getting knocked out by Julie, getting tied up, being shoved with a violet wand, before Julie finally plays nice and lets her have several forced orgasms with a vibrator. Jewell Marceau, dressed in red latex, is treated to a severe one-legged suspension that has her balancing on one knee while her hair is tied up above her. Also, features a multi-layer gag! Nobo 2.5 3 2009-09-18 Mature Adult Nospankingyoungbondagebodyexperiencetiedniceforcedfinallyplayorgasmorgasmsdoeswhitetorturenightgaggedjulielovesropeashleylearnhairhappypantiesstockingsheelsvibratorjewelllatexfeature,clothes,played,complete,marceau,severe,jewell marceau http://www.iphods.com/movie/432/bondage-lovers/ http://www.iphods.com/videos/89d7c0f5e02b9d714c847be8133b2006.m4v http://www.iphods.com/clips/thumbs/89d7c0f5e02b9d714c847be8133b2006.jpg Bondage Lovers Julie Simone's not happy unless someone is tied up and gagged! 5 on-screen tying scenes featuring the top names in bondage tied by the best rigger in the industry, Julie Simone. Allanah Rhodes looks adorable in white cotton socks and panties as she and Julie spend a romantic night at home, in ropes! Madison Young, in a corset, heels and stockings, is placed over Julie's knee for an OTK spanking, before getting tied up, tortured and played with. Her reward: several forced orgasms! Ashley Renee gets to experience being a room ornament, complete with breast clothespins, first-hand! Mary Jane learns that she loves bondage after all, after cat fighting and getting knocked out by Julie, getting tied up, being shoved with a violet wand, before Julie finally plays nice and lets her have several forced orgasms with a vibrator. Jewell Marceau, dressed in red latex, is treated to a severe one-legged suspension that has her balancing on one knee while her hair is tied up above her. Also, features a multi-layer gag! Nobo 4.5 3 2009-09-18 Mature Adult Nospankingyoungbondagebodyexperiencetiedniceforcedfinallyplayorgasmorgasmsdoeswhitetorturenightgaggedjulielovesropeashleylearnhairhappypantiesstockingsheelsvibratorjewelllatexfeature,clothes,played,complete,marceau,severe,jewell marceau http://www.iphods.com/movie/432/bondage-lovers/ http://www.iphods.com/videos/c3038ffc0883c5cc1629cf353ff44c5d.m4v http://www.iphods.com/clips/thumbs/c3038ffc0883c5cc1629cf353ff44c5d.jpg Bondage Lovers Julie Simone's not happy unless someone is tied up and gagged! 5 on-screen tying scenes featuring the top names in bondage tied by the best rigger in the industry, Julie Simone. Allanah Rhodes looks adorable in white cotton socks and panties as she and Julie spend a romantic night at home, in ropes! Madison Young, in a corset, heels and stockings, is placed over Julie's knee for an OTK spanking, before getting tied up, tortured and played with. Her reward: several forced orgasms! Ashley Renee gets to experience being a room ornament, complete with breast clothespins, first-hand! Mary Jane learns that she loves bondage after all, after cat fighting and getting knocked out by Julie, getting tied up, being shoved with a violet wand, before Julie finally plays nice and lets her have several forced orgasms with a vibrator. Jewell Marceau, dressed in red latex, is treated to a severe one-legged suspension that has her balancing on one knee while her hair is tied up above her. Also, features a multi-layer gag! Nobo 2 3 2009-09-18 Mature Adult Nospankingyoungbondagebodyexperiencetiedniceforcedfinallyplayorgasmorgasmsdoeswhitetorturenightgaggedjulielovesropeashleylearnhairhappypantiesstockingsheelsvibratorjewelllatexfeature,clothes,played,complete,marceau,severe,jewell marceau http://www.iphods.com/movie/467/girls-kissing-girls/ http://www.iphods.com/videos/c055b3520d11c2c0eb44c3fcaced5dcf.m4v http://www.iphods.com/clips/thumbs/c055b3520d11c2c0eb44c3fcaced5dcf.jpg Girls Kissing Girls 2009 Feminist Porn Award Nominee.2009 AVN Award Nominee for Best All-Girl ReleaseLesbians love to kiss, and this video pays homage to the lost art of osculation. In this hot, romantic video, young girls take their time exploring the lips, tongues, and mouths of their sexy young lovers. Top lesbian star Elexis Monroe, adorable young Annabelle Lee, and stunning redhead Mz. Berlin let their passions for each other run wild, while Trinity Post shows submissive Sinn Sage how to enjoy the art of lesbian tongue-play. 2.5 3 2009-08-28 Mature Adult Nogirlslovesexylesbianwildvideoplaylesbianstonguesubmissivekissnomineeberlinawardlipsfeministfeminist pornreleasemouthsaward nomineeloverslover http://www.iphods.com/movie/467/girls-kissing-girls/ http://www.iphods.com/videos/7fd12418967e4eeb10fcbb5c4a710272.m4v http://www.iphods.com/clips/thumbs/7fd12418967e4eeb10fcbb5c4a710272.jpg Girls Kissing Girls 2009 Feminist Porn Award Nominee.2009 AVN Award Nominee for Best All-Girl ReleaseLesbians love to kiss, and this video pays homage to the lost art of osculation. In this hot, romantic video, young girls take their time exploring the lips, tongues, and mouths of their sexy young lovers. Top lesbian star Elexis Monroe, adorable young Annabelle Lee, and stunning redhead Mz. Berlin let their passions for each other run wild, while Trinity Post shows submissive Sinn Sage how to enjoy the art of lesbian tongue-play. 3 3 2009-08-28 Mature Adult Nogirlslovesexylesbianwildvideoplaylesbianstonguesubmissivekissnomineeberlinawardlipsfeministfeminist pornreleasemouthsaward nomineeloverslover http://www.iphods.com/movie/467/girls-kissing-girls/ http://www.iphods.com/videos/407aa3446b02dc3f8af6894ea8418b3b.m4v http://www.iphods.com/clips/thumbs/407aa3446b02dc3f8af6894ea8418b3b.jpg Girls Kissing Girls 2009 Feminist Porn Award Nominee.2009 AVN Award Nominee for Best All-Girl ReleaseLesbians love to kiss, and this video pays homage to the lost art of osculation. In this hot, romantic video, young girls take their time exploring the lips, tongues, and mouths of their sexy young lovers. Top lesbian star Elexis Monroe, adorable young Annabelle Lee, and stunning redhead Mz. Berlin let their passions for each other run wild, while Trinity Post shows submissive Sinn Sage how to enjoy the art of lesbian tongue-play. 3.5 3 2009-08-28 Mature Adult Nogirlslovesexylesbianwildvideoplaylesbianstonguesubmissivekissnomineeberlinawardlipsfeministfeminist pornreleasemouthsaward nomineeloverslover http://www.iphods.com/movie/475/whale-tail/ http://www.iphods.com/videos/5376aad10bbda3cf5f40ab827e0cecac.m4v http://www.iphods.com/clips/thumbs/5376aad10bbda3cf5f40ab827e0cecac.jpg Whale Tail There she blows, there's no mistaking the sight of a whale tail! Next time your out in public checking out the sluts, peep that cutie bending over in front of you innocently revealing that G string popping out of her jeans. Nothing is sexier and nothing can stop the fantasy of ripping down her pants and pulling that tail to the side. Let the sucking and fucking begin as these Whale Tails are so amazing we had to shove it deep in some of their asses too! 5 3 2009-08-28 Mature Adult Nosuckingsuckslutsslutfantasyblowassesinnocentpublic http://www.iphods.com/movie/475/whale-tail/ http://www.iphods.com/videos/467ff9a77e9055404ac2a0ad75586fd4.m4v http://www.iphods.com/clips/thumbs/467ff9a77e9055404ac2a0ad75586fd4.jpg Whale Tail There she blows, there's no mistaking the sight of a whale tail! Next time your out in public checking out the sluts, peep that cutie bending over in front of you innocently revealing that G string popping out of her jeans. Nothing is sexier and nothing can stop the fantasy of ripping down her pants and pulling that tail to the side. Let the sucking and fucking begin as these Whale Tails are so amazing we had to shove it deep in some of their asses too! 5 3 2009-08-28 Mature Adult Nosuckingsuckslutsslutfantasyblowassesinnocentpublic http://www.iphods.com/movie/492/busty-alexis-silver-36g/ http://www.iphods.com/videos/9e168da220120a7f2cfbbd67783ad4fb.m4v http://www.iphods.com/clips/thumbs/9e168da220120a7f2cfbbd67783ad4fb.jpg Busty Alexis Silver 36G Direct from our studio in California, CUMS our first volume of Alexis Silver, our busty slut with 36 G's. She is another young and busty, super horny babe just for you! Sit back and relax as our new honey entertain you. Watch Alexis Silver's best sex scenes ever... including her first hardcore anal scene ever recorded! 3.5 3 2009-08-21 Mature Adult Noyounghornyhardcorecumsbustyhardcore analsex scene http://www.iphods.com/movie/494/daddys-little-princess-4/ http://www.iphods.com/videos/b5f1b7a2ba667f34539029c3ecf8dd38.m4v http://www.iphods.com/clips/thumbs/b5f1b7a2ba667f34539029c3ecf8dd38.jpg Daddy's Little Princess 4 Daddy's little princes is all grown up, and she likes to fuck. She is spreading their legs and get it in every hole you want to put it in, and if you wanna bring you buddy then you are more than welocome he can have one hole while you pound the other. 2.5 3 2009-08-21 Mature Adult Nolegsspread http://www.iphods.com/movie/499/queens-of-trample/ http://www.iphods.com/videos/ca6cf521899b20d54716d925594548c9.m4v http://www.iphods.com/clips/thumbs/ca6cf521899b20d54716d925594548c9.jpg Queens Of Trample For the first time ever the MOST INTENSE, MOST BEAUTIFUL and MOST BRUTAL TRAMPLING MISTRESS are on one video. SIX VICIOUS VIXENS! TWELVE FEROCIOUS FEET in nonstop STOMPING ACTION! Shot during tapings of "Playboy Sexcetera" with SCOTT POTASNIK (host of the Playboy Sexcetera show), this video takes you both into the action and behind the scenes. The action begins with an incredible DOUBLE TRAMPLE of Slave Jonesy by the certifiably DEMENTED MISTRESS SANDRA ROMAINE and BIG TITTED BLONDE MISTRESS BARBARA SUMMERS. Their HIGH HEELS DIG DEEP into the slave's flesh as they stream VERBAL ABUSE. Then the ladies go solo. First Barbara takes her time crushing him and making him SUCK HER SPIKED HEEL, then Sandra goes to town, jumping on Jonsey and actually JOGGING ON HIM! Scott is encouraged to see how it feels to be trampled. BIG MISTAKE! Sandra and Barbara make him scream and leave him with a lasting and painful impression! Sandra and Barbara then team up again to TRAMPLE Slave Tom. He thinks he's a tough guy, but 3.5 3 2009-08-21 Mature Adult Nobeautifulpainslaveladiesbodymistressdeepdoublevideoplayblondefeetbehindintensehighhugejoinbarecreamskinfirst timepoormistressesshoesslavesheelsfloorincredible http://www.iphods.com/movie/502/naked-olympics/ http://www.iphods.com/videos/4d6f855a0646e167a03775646ac45cdb.m4v http://www.iphods.com/clips/thumbs/4d6f855a0646e167a03775646ac45cdb.jpg naked olympics Visit the most prestigious all girl track and field university - the hottest students while training for the Olympics engage in the wettest sex ever. The La Perla Lingerie come off and these girls become wilder than they could ever be at home. They are so horny and the boys and soviet spies sneak in at all hours and the girls greet them with open cunt holes and hold penises in their fragile hands and mouths and help to insert them into each others virgin anuses and pussy tunnels - some times the whole huge beautiful super model all girl team lines up to each taste a new cock - sexual tortures for team secrets, trembling anal devirginizations - the girls use the cum for new powers and eat and strangle on each semen snow wad. The hottest babes you will ever see. A remarkable collectors edition. Go for the gold if not then go for the pussy! Lil women rule! 3 3 2009-08-21 Mature Adult Nopussygirlbeautifulhandshottesthornywomenwildanalmouthboystortureholeshugetrainingsecretmouthscuntlingeriepower http://www.iphods.com/movie/502/naked-olympics/ http://www.iphods.com/videos/37a15bb3a7e1621af6b004726e7f9067.m4v http://www.iphods.com/clips/thumbs/37a15bb3a7e1621af6b004726e7f9067.jpg naked olympics Visit the most prestigious all girl track and field university - the hottest students while training for the Olympics engage in the wettest sex ever. The La Perla Lingerie come off and these girls become wilder than they could ever be at home. They are so horny and the boys and soviet spies sneak in at all hours and the girls greet them with open cunt holes and hold penises in their fragile hands and mouths and help to insert them into each others virgin anuses and pussy tunnels - some times the whole huge beautiful super model all girl team lines up to each taste a new cock - sexual tortures for team secrets, trembling anal devirginizations - the girls use the cum for new powers and eat and strangle on each semen snow wad. The hottest babes you will ever see. A remarkable collectors edition. Go for the gold if not then go for the pussy! Lil women rule! 2.5 3 2009-08-21 Mature Adult Nopussygirlbeautifulhandshottesthornywomenwildanalmouthboystortureholeshugetrainingsecretmouthscuntlingeriepower http://www.iphods.com/movie/506/savage-security/ http://www.iphods.com/videos/cf030f120830dbc29af386938006364c.m4v http://www.iphods.com/clips/thumbs/cf030f120830dbc29af386938006364c.jpg Savage Security The savage security agency specialises in high profile protection. Their newest detail is the daughter of an eccentric billionaire. She has received seceral threats from an unknown assailant. It is Gina Lynn's job to keep her out of Harm's way! 4.5 3 2009-08-18 Mature Adult Nohighlynndaughter http://www.iphods.com/movie/507/fudgestick-volume-1/ http://www.iphods.com/videos/0ddd07af9b66ed0f269d91735af9c058.m4v http://www.iphods.com/clips/thumbs/0ddd07af9b66ed0f269d91735af9c058.jpg Fudgestick Volume 1 Laronn James is Fudgestick. Four horny big titty milfs go head to head with Laronn's meaty fudgestick in four scenes of nonstop rough interracial hardcore anal action. Laronn trains these MILFs to eat ass and take the fudgestick deep into all three holes. Moxxie is a tattooed MILF who has never been afraid of the dark. Kayla Quinn is a corn fed Southern white MILF that got booty like a black girl. Tabitha is an upper class MILF on vacation from New York to do some dirt that she doesn't want her husband to know about. Natasha Stone is a country ass milf coming to L.A. to get some rough ghetto lovin' with 10 inches of big black cock in nonstop rough action. All interracial, all amateur, all mature. 3.5 3 2009-08-15 Mature Adult Nohornydeepanalblackhardcoredoeswhitefourholesamateurdarkbootyhusbandmilfmilfsbig blackhardcore analinterracialinches http://www.iphods.com/movie/513/monsters-of-she-male-cock-5/ http://www.iphods.com/videos/44089bb7e67ecd7d0b4df0ada9c7edfc.m4v http://www.iphods.com/clips/thumbs/44089bb7e67ecd7d0b4df0ada9c7edfc.jpg Monsters Of She Male Cock 5 Bigger is better, everybody knows that, but what happens when you have to deal with huge! As in Monsters? Well, if youre talking about SheMales, monsters are fucking swesome. Just check out these heavy hung chicks to see what being built really means. Imagine trying to stretch your mouth over one of these trobbing cocks. And then think how it wold feel up your ass! Ouch, that's big! 4.5 3 2009-08-14 Mature Adult Nofuckingbodyverycockschickshugeheavyshemalesmalemonster http://www.iphods.com/movie/513/monsters-of-she-male-cock-5/ http://www.iphods.com/videos/1e34427f97434b00d2e3ea397fd3d09e.m4v http://www.iphods.com/clips/thumbs/1e34427f97434b00d2e3ea397fd3d09e.jpg Monsters Of She Male Cock 5 Bigger is better, everybody knows that, but what happens when you have to deal with huge! As in Monsters? Well, if youre talking about SheMales, monsters are fucking swesome. Just check out these heavy hung chicks to see what being built really means. Imagine trying to stretch your mouth over one of these trobbing cocks. And then think how it wold feel up your ass! Ouch, that's big! 5 3 2009-08-14 Mature Adult Nofuckingbodyverycockschickshugeheavyshemalesmalemonster http://www.iphods.com/movie/519/san-francisco-lesbian-bondage-club-2/ http://www.iphods.com/videos/9a54eb9525cd518c25816f5bc63b890f.m4v http://www.iphods.com/clips/thumbs/9a54eb9525cd518c25816f5bc63b890f.jpg San Francisco Lesbian Bondage Club #2 Second in a series of Mistress Domination. Get ready for some tight nipple clipping and flogging ripe red butts are just some of the delightful punishments doled out by and to these bad babes. Toys and bondage center on women doing women who could ask for more? 3 3 2009-08-14 Mature Adult Nobondagepunishmentmistresswomenbutttoysseconddominationnipple http://www.iphods.com/movie/521/body-builders-in-heat/ http://www.iphods.com/videos/de16b70f37594f90ef255eb5d0fe5661.m4v http://www.iphods.com/clips/thumbs/de16b70f37594f90ef255eb5d0fe5661.jpg Body Builders In Heat Watch these buff babes power fuck and suck! They pump iron all day and pump cock all night! See these buff beauties unleash the raw muscle and powerful pussy that will claim any man's cock! You better be prepared to give them what they want, or they might just body-slam you!! 3 3 2009-08-14 Mature Adult Nocockbodynightpumppower http://www.iphods.com/movie/522/nasty-lesbian-lovers/ http://www.iphods.com/videos/b91182d9ba7a68f7c62dca1b3cd70fb7.m4v http://www.iphods.com/clips/thumbs/b91182d9ba7a68f7c62dca1b3cd70fb7.jpg Nasty Lesbian Lovers Watch this uncensored lesbian lust. No men allowed. See some of porn's HOTTEST pussy packing bitches. Watch as she rams her ass and her pussy cause she is just ripe for the fucking. These horny sluts are craving the sweet taste of dripping pussy. Warning: Watch at your own risk. 3 3 2009-08-14 Mature Adult Nolesbianhottestslutsporndrippingcravingbitches http://www.iphods.com/movie/523/maid-for-punishment/ http://www.iphods.com/videos/37872398714b3f7dafad84cf9edb106f.m4v http://www.iphods.com/clips/thumbs/37872398714b3f7dafad84cf9edb106f.jpg Maid For Punishment After inheriting millions of dollars, Jacqueline and Michael decide to hire a maid staff to care for their estate. Instead of ordinary housekeepers, they choose to offer $100,000 for young ladies who will submit to Jacqueline's sadistic desires. Jessica and Jennifer accept the offer because they need the money; Jasmine accepts the job in order to fulfill her lifelong desire to be a pleasure slave. This movie chronicles the first four months at the Estate in which you will witness all three young ladies punished far beyond their limits. Spankings that lead to tears and a bruised bottom are a daily occurrence. You will even get a peak behind closed doors, where Jacqueline explores the more sexual side of domination. 4 3 2009-08-14 Mature Adult Nospankingyoungladiessexualevenfourlifebottomthreebehinddoordominationclose100% http://www.iphods.com/movie/523/maid-for-punishment/ http://www.iphods.com/videos/4e594dd2e0a889d37c237f522ed85e4f.m4v http://www.iphods.com/clips/thumbs/4e594dd2e0a889d37c237f522ed85e4f.jpg Maid For Punishment After inheriting millions of dollars, Jacqueline and Michael decide to hire a maid staff to care for their estate. Instead of ordinary housekeepers, they choose to offer $100,000 for young ladies who will submit to Jacqueline's sadistic desires. Jessica and Jennifer accept the offer because they need the money; Jasmine accepts the job in order to fulfill her lifelong desire to be a pleasure slave. This movie chronicles the first four months at the Estate in which you will witness all three young ladies punished far beyond their limits. Spankings that lead to tears and a bruised bottom are a daily occurrence. You will even get a peak behind closed doors, where Jacqueline explores the more sexual side of domination. 3 3 2009-08-14 Mature Adult Nospankingyoungladiessexualevenfourlifebottomthreebehinddoordominationclose100% http://www.iphods.com/movie/524/secretary-thing/ http://www.iphods.com/videos/dcca1b33bf360cf92ea9923629c32b87.m4v http://www.iphods.com/clips/thumbs/dcca1b33bf360cf92ea9923629c32b87.jpg Secretary Thing 2009 AVN Award Nominee for Best Vignette Release Special Note: This Is Movie # 100,000 In Our VOD Library!!! Patrick Collins proudly presents, It's A Secretary Thing, a collection of stunning superstars dressed up as seductive secretaries. Watch the curvaceous Shyla Stylez, alongside Jenaveve Jolie, Karlie Montana, Carli Banks, Ashley Blue, Evie Delatosso, and Jamie Lamore. It's a Secretary Thing is a depiction of fantasy role-playing at its best. In an industry that is over saturated with unoriginal couch sex, Patrick Collins focuses on creative scenarios, chemistry between performers and real female orgasms. His movies are unlike anything else in porn. 2.5 3 2009-08-13 Mature Adult Noplayorgasmspornfemalestylenomineesecretashleyfantasyreleaseavn awardaward nomineecollectioncarlicollinssuperstarmalemoviesoriginal100%blue http://www.iphods.com/movie/527/flower-squirt-shower-6/ http://www.iphods.com/videos/3934cec4893fb32ded8429719f2a9d3f.m4v http://www.iphods.com/clips/thumbs/3934cec4893fb32ded8429719f2a9d3f.jpg Flower Squirt Shower 6 2009 AVN Award Nominee for Best Squirting ReleaseThe AVN award winning series, Flower's Squirt Shower, returns with the sixth volume, starring the goddess of gush, porn super star Flower Tucci. Volume's 2 and 3 have both been recipient's of AVN editor's choice reviews, and at this year's AVN awards the series won for Best Specialty Release - Squirting. Squirt Shower 6 is bigger, better, and wetter than ever. Featuring a squirt drenched bevy of beautiful starlets including Jada Fire, Sindee Jennings, Britney Stevens, Nicki Hunter, and Gianna. While there are many imitators, Elegant Angel is the company that porn fans can rely upon for squirting movies that celebrate female orgasms with camera work that doesn't stay wide when you want it to get up close and intimate. Director William H.'s camera lens is once again squirt soaked, as Flower Tucci subjects us to a relentless onslaught of female ejaculation. 2 3 2009-08-12 Mature Adult Nobeautifulevenorgasmorgasmsporndoesfemalecameranomineeawardintimateangelsquirtingreleaseavn awardsquirtaward nomineedirectorelegant angelgoddessflowermalemoviesviewclosefans http://www.iphods.com/movie/529/squirting-201-vol-3/ http://www.iphods.com/videos/83bb70e4107d34e59af1f315b4b39fc2.m4v http://www.iphods.com/clips/thumbs/83bb70e4107d34e59af1f315b4b39fc2.jpg Squirting 201 Vol 3 Just when you thought it couldn't get more fun, more sexy, more outrageous, and more educational, Axel Braun once again tops himself and brings you another female ejaculation masterpiece! You will be shocked by seeing how much juice a woman can squirt. You will be amazed by learning how easy it is. And, ultimately, you'll become a believer! Get ready to get wet!!! 3 3 2009-08-11 Mature Adult Nomasterwomanfemalelearnsquirtmaleultimateshocked http://www.iphods.com/movie/529/squirting-201-vol-3/ http://www.iphods.com/videos/94da0db736b8795d4e475d136fe07507.m4v http://www.iphods.com/clips/thumbs/94da0db736b8795d4e475d136fe07507.jpg Squirting 201 Vol 3 Just when you thought it couldn't get more fun, more sexy, more outrageous, and more educational, Axel Braun once again tops himself and brings you another female ejaculation masterpiece! You will be shocked by seeing how much juice a woman can squirt. You will be amazed by learning how easy it is. And, ultimately, you'll become a believer! Get ready to get wet!!! 3.5 3 2009-08-11 Mature Adult Nomasterwomanfemalelearnsquirtmaleultimateshocked http://www.iphods.com/movie/530/pornolympics-the-anal-games/ http://www.iphods.com/videos/a4f0efcf20b3d003cb656a86a79f6916.m4v http://www.iphods.com/clips/thumbs/a4f0efcf20b3d003cb656a86a79f6916.jpg Pornolympics: The Anal Games 2009 AVN Award Nominee for Best Director Foreign Non-Feature and Best Foreign All Sex Release The important thing isn't to win but to FUCK! These are the horniest games ever! Includes orgies, DPs, lesbians, dildo and ass fucking with 22 sluts battling for gold in the world championship of fucking! This is definitely not the "Special Olympics"; it's the PORNOLYMPICS! The only Olympic games where everyone walks away with a "PRIZE," including the pretty Asian commentator. She took home a "gold star" for being a good sport in the bukkake game! 4 3 2009-08-11 Mature Adult Nolesbianfuckingveryslutsprettypornlesbiansslutdildonomineeawardasianincludesgamesreleaseavn awardaward nomineedirectorfeaturebest director http://www.iphods.com/movie/531/little-midget-big-dicks-2/ http://www.iphods.com/videos/fff606e810691f34863bf22b38d11960.m4v http://www.iphods.com/clips/thumbs/fff606e810691f34863bf22b38d11960.jpg Little Midget Big Dicks #2 Can she take it? You bet she can! This horny little lady just loves great big cocks! Midget gets it on with some of the biggest dicks in town. You would think their half pint size just wouldn't fit so much dick, but you would be wrong they crave it and take every inch! 4.5 3 2009-08-08 Mature Adult Nodickcockslovesladydicksbiggest http://www.iphods.com/movie/535/milfs-gone-anal-vol-4/ http://www.iphods.com/videos/75c66d431d85e705652cc17971456b56.m4v http://www.iphods.com/clips/thumbs/75c66d431d85e705652cc17971456b56.jpg MILFS Gone Anal Vol. 4 Mama's taking it in the crack and she isn't ever coming back! Watch as some of our hottest MILFs turn into anal queens that just can't seem to get enough hard cock rammed in their ass! The Pink Visual crew is always obliged to help in a good ass fucking and we definitely like to take care of mama! 2 3 2009-08-08 Mature Adult Nofuckinghottestanalalwayshard cockmilfmilfsqueen http://www.iphods.com/movie/535/milfs-gone-anal-vol-4/ http://www.iphods.com/videos/4241b9d93c7b329ba408901a947f9808.m4v http://www.iphods.com/clips/thumbs/4241b9d93c7b329ba408901a947f9808.jpg MILFS Gone Anal Vol. 4 Mama's taking it in the crack and she isn't ever coming back! Watch as some of our hottest MILFs turn into anal queens that just can't seem to get enough hard cock rammed in their ass! The Pink Visual crew is always obliged to help in a good ass fucking and we definitely like to take care of mama! 3.5 3 2009-08-08 Mature Adult Nofuckinghottestanalalwayshard cockmilfmilfsqueen http://www.iphods.com/movie/536/teenage-brotha-lovers-9/ http://www.iphods.com/videos/1c1298668e135d7356a82a04d30c9719.m4v http://www.iphods.com/clips/thumbs/1c1298668e135d7356a82a04d30c9719.jpg Teenage Brotha Lovers 9 Barely legal cuties, fresh out of high school, love that big black meat! They want to walk on the dark side and they get the toughest of meat... black meat! Full and ready to pound these little cuties until they explode all over there faces! It's all about the young chicks! 2.5 3 2009-08-08 Mature Adult Noloveschoolblackchickshighbaredarkchickfacesbig black http://www.iphods.com/movie/538/world-without-men/ http://www.iphods.com/videos/256586670a8774b1e4c9a1d638a68b01.m4v http://www.iphods.com/clips/thumbs/256586670a8774b1e4c9a1d638a68b01.jpg World Without Men In a film that could be subtitled World Without Knickers, some very attractive Brit girls do unspeakably dirty things to their own and their friend's pussies, often while tying each other up. Imaginatively photographed, the four scenes include all kinds of kinkiness! These bitches are hot! High quality lesbo fetish filth at its best! 3 3 2009-08-08 Mature Adult Nogirlsfilmfourfetishdirtyhighbitches http://www.iphods.com/movie/538/world-without-men/ http://www.iphods.com/videos/8c27751928a542b28b6194628e01d2f6.m4v http://www.iphods.com/clips/thumbs/8c27751928a542b28b6194628e01d2f6.jpg World Without Men In a film that could be subtitled World Without Knickers, some very attractive Brit girls do unspeakably dirty things to their own and their friend's pussies, often while tying each other up. Imaginatively photographed, the four scenes include all kinds of kinkiness! These bitches are hot! High quality lesbo fetish filth at its best! 3 3 2009-08-08 Mature Adult Nogirlsfilmfourfetishdirtyhighbitches http://www.iphods.com/movie/541/whorelore-season-1-episode-04-man-hunt/ http://www.iphods.com/videos/c4457e7f8853dcbd40e0fccf4c9d4853.m4v http://www.iphods.com/clips/thumbs/c4457e7f8853dcbd40e0fccf4c9d4853.jpg WhoreLore Season 1: Episode 04 - Man Hunt In "Man Hunt", Episode 4 of the WhoreLore series, the guild master Titus is captured and tortured by an evil gang of thugs. Held in a heavily guarded woodland camp, our heroes must save him before it is too late. Our Hunter calls on her feral companion to aid her in the rescue. 2.5 3 2009-08-08 Mature Adult Nomastertorturecallcamp http://www.iphods.com/movie/541/whorelore-season-1-episode-04-man-hunt/ http://www.iphods.com/videos/48c729ca47a549ad6f59d44e3aa2978e.m4v http://www.iphods.com/clips/thumbs/48c729ca47a549ad6f59d44e3aa2978e.jpg WhoreLore Season 1: Episode 04 - Man Hunt In "Man Hunt", Episode 4 of the WhoreLore series, the guild master Titus is captured and tortured by an evil gang of thugs. Held in a heavily guarded woodland camp, our heroes must save him before it is too late. Our Hunter calls on her feral companion to aid her in the rescue. 3.5 3 2009-08-08 Mature Adult Nomastertorturecallcamp http://www.iphods.com/movie/541/whorelore-season-1-episode-04-man-hunt/ http://www.iphods.com/videos/7764f616094d80ab8aa3ab3f56b82b92.m4v http://www.iphods.com/clips/thumbs/7764f616094d80ab8aa3ab3f56b82b92.jpg WhoreLore Season 1: Episode 04 - Man Hunt In "Man Hunt", Episode 4 of the WhoreLore series, the guild master Titus is captured and tortured by an evil gang of thugs. Held in a heavily guarded woodland camp, our heroes must save him before it is too late. Our Hunter calls on her feral companion to aid her in the rescue. 4 3 2009-08-08 Mature Adult Nomastertorturecallcamp http://www.iphods.com/movie/542/teenage-anal-eruptions/ http://www.iphods.com/videos/74416c7281ef02ec79cac104617d9ee9.m4v http://www.iphods.com/clips/thumbs/74416c7281ef02ec79cac104617d9ee9.jpg Teenage Anal Eruptions As if their fresh pussies weren't tight enough, these fresh young sluts spread open their virgin assholes for first time cum floods! Includes only the raunchiest taboo loops, including: Devil Cult: A black magic ritual turns a tiny virgin into an anal craving whore! Park Lovers: John Holmes takes a sweet young thing on a field trip to the zoo before jamming all 12" of cock up her rectum! Includes the absolute classic Tawny Pearl roller skating loop and more! 4 3 2009-08-08 Mature Adult Noloveyoungtightanalblackslutspussiesslutholesassholesincludescravingclassicfirst timeassholeloversloverspread http://www.iphods.com/movie/546/taboo-charming-mother-vol-6-immoral-tears/ http://www.iphods.com/videos/3b6e8271a6c86e81b018a993bf85f605.m4v http://www.iphods.com/clips/thumbs/3b6e8271a6c86e81b018a993bf85f605.jpg Taboo Charming Mother Vol. 6 - Immoral Tears 2009 AVN Award Nominee for Best Animated Release Kazuhiko continues the sexual rendezvous with his stepmother's sister, his aunt Emiko. Now his stepmother Misako's jealousy grows by the second. She soon realizes that she no longer needs her husband Yosuke. Instead, the one she truly desires both mentally and physically is Kazuhiko, however she only has a few days to make a decision whether to be his lover or go back to being a normal family.This movie is featured in the original Japanese with English subtitles. 3 3 2009-08-01 Mature Adult Nonomineeawardsecondhusbandreleasejapaneseavn awardaward nomineefeaturedcontinuesloverfeatureoriginaltruly http://www.iphods.com/movie/546/taboo-charming-mother-vol-6-immoral-tears/ http://www.iphods.com/videos/3f5ca1bf5e953cccf8dfc2bbc79364f7.m4v http://www.iphods.com/clips/thumbs/3f5ca1bf5e953cccf8dfc2bbc79364f7.jpg Taboo Charming Mother Vol. 6 - Immoral Tears 2009 AVN Award Nominee for Best Animated Release Kazuhiko continues the sexual rendezvous with his stepmother's sister, his aunt Emiko. Now his stepmother Misako's jealousy grows by the second. She soon realizes that she no longer needs her husband Yosuke. Instead, the one she truly desires both mentally and physically is Kazuhiko, however she only has a few days to make a decision whether to be his lover or go back to being a normal family.This movie is featured in the original Japanese with English subtitles. 4 3 2009-08-01 Mature Adult Nonomineeawardsecondhusbandreleasejapaneseavn awardaward nomineefeaturedcontinuesloverfeatureoriginaltruly http://www.iphods.com/movie/548/oil-overload-disc-1/ http://www.iphods.com/videos/aaa8a051d8259a2197a2a2b9f3341d9c.m4v http://www.iphods.com/clips/thumbs/aaa8a051d8259a2197a2a2b9f3341d9c.jpg Oil Overload (Disc 1) 2009 AVN Award Nominee for Best Director Non-Feature and Best Gonzo ReleaseSuperstars lubed and cum-hungry for an overload of throbbing cocks! These slippery sluts are sliding all over the place getting ready to be fried in a batch of cum! Without a need for KY they can slide into anyone of their waiting holes and hungry faces. These girls love a messy fuck!! 2.5 3 2009-08-01 Mature Adult Nogirlslovegirlslutscocksslutholesnomineeawardreleaseavn awardaward nomineedirectorfacesfeaturesuperstarbest director http://www.iphods.com/movie/552/next-door-bi-encounter-vol-1/ http://www.iphods.com/videos/657e6f50214060792a0dea8d52b76db7.m4v http://www.iphods.com/clips/thumbs/657e6f50214060792a0dea8d52b76db7.jpg Next Door: Bi-Encounter Vol. 1 This is the one you have been waiting for! Next Door Studios releases its VERY FIRST Bi-Sexual DVD! Oh and did we mention that everybody's favorite Tyler Cummings is one of the main stars! This is your chance to see Tyler Cummings play with another man's cock, as well as has have his cock sucked and jerked by other hot guys, while engaged in some of the hottest Bi-Sexual action we have ever got on film! Six steamy scenes - sexy threesomes and even a foursome. 4 3 2009-08-01 Mature Adult Nohottestbodyfilmguyssuckplayfourthreedoorsteamyfavoriterelease http://www.iphods.com/movie/558/best-of-eden-38dd/ http://www.iphods.com/videos/0c90e32ddb0839575b9b07e6dafcd1ee.m4v http://www.iphods.com/clips/thumbs/0c90e32ddb0839575b9b07e6dafcd1ee.jpg Best Of Eden 38DD Eden is busty, beautiful, and bodacious! Watch all her best XXX fuck scenes right here on one DVD! Loaded with titty fuckin', ass poundin', and dick suckin' action! This is one BBW that will make you want to shoot your load all over the place! Her big titties are not to be undermined! 2.5 3 2009-07-28 Mature Adult Nodicksuckbustyshoot http://www.iphods.com/movie/558/best-of-eden-38dd/ http://www.iphods.com/videos/8c4605efb4d820e5e135ea33848c8eb0.m4v http://www.iphods.com/clips/thumbs/8c4605efb4d820e5e135ea33848c8eb0.jpg Best Of Eden 38DD Eden is busty, beautiful, and bodacious! Watch all her best XXX fuck scenes right here on one DVD! Loaded with titty fuckin', ass poundin', and dick suckin' action! This is one BBW that will make you want to shoot your load all over the place! Her big titties are not to be undermined! 3.5 3 2009-07-28 Mature Adult Nodicksuckbustyshoot http://www.iphods.com/movie/559/redhead-realtor/ http://www.iphods.com/videos/21fb66f31f02a5d972a435e31202ce5a.m4v http://www.iphods.com/clips/thumbs/21fb66f31f02a5d972a435e31202ce5a.jpg Redhead Realtor This realtor is all about the customer! She gives a tour, lets you know about any plumbing problems, and then she starts talking closing costs...starting with sucking your huge hard cock. Then she rides it until you don't think you can take anymore! She's a full service professional, always leaving the customer satisfied. 4.5 3 2009-07-24 Mature Adult Nosuckingsuckridehugealwayshard cock http://www.iphods.com/movie/563/bound-gagged-damsels-2/ http://www.iphods.com/videos/17a004c7b62ad4fcd2e040d12efe1f0e.m4v http://www.iphods.com/clips/thumbs/17a004c7b62ad4fcd2e040d12efe1f0e.jpg Bound and Gagged Damsels 2 Eight bondage tales with serious damsel action! Abduction! Ransom! Full nudity and fondling! Kidnappings with onscreen grabbing, tying, gagging and molesting -- this is a bondage film not to be missed if you are a diehard fan of damsel-in-distress action! Eight scenes, eleven hot models, 75 minutes! 5 3 2009-07-24 Mature Adult Nobondagefilm http://www.iphods.com/movie/560/its-a-daddy-thing-4/ http://www.iphods.com/videos/bf31709787db481f643d3302ae80da91.m4v http://www.iphods.com/clips/thumbs/bf31709787db481f643d3302ae80da91.jpg It's A Daddy Thing! 4 2009 AVN Award Winner for Best Young Girl Series.Patrick Collins returns with another collection of prissy, cock teasing teens in Elegant Angel's It's a Daddy Thing 4. Alexis Love, Evie Delatosso, Nika, Naomi Cruise, and Nikki Flame star as filthy young flirtatious sluts, provocatively seducing older guys. The movie is a sexually sophisticated depiction of fantasy role-playing at its best. Elegant Angel is the porn company that customers can rely upon for a more creative brand of eroticism. 2 3 2009-07-24 Mature Adult Nococklovegirlguysplayslutspornsluteroticawardwinnerangelolderteasingfantasyavn awardcollectionelegant angelcollinssexuallyaward winnerfilthy http://www.iphods.com/movie/586/squirt-gangbang/ http://www.iphods.com/videos/e29b650537319b9d5aed14f355a7c919.m4v http://www.iphods.com/clips/thumbs/e29b650537319b9d5aed14f355a7c919.jpg Squirt Gangbang 2008 AVN Award Nominee for Best Squirting Release. Elegant Angel proudly presents the eagerly anticipated SQUIRT GANGBANG, starring Sasha Grey and Chelsie Rae. This movie is a torrential downpour of epic proportions. Imagine all of your favorite squirting vixens together in one room, directing all of their focus on drenching one very lucky (and very wet) porn princess. If you think you've seen squirting before in Squirtwoman, Swallow My Squirt, and Squirt In My Gape, then think again. SQUIRT GANGBANG is arguably greatest squirt series of them all and a non ride of orgasmic eruptions. DO NOT MISS! 3.5 3 2009-07-11 Mature Adult Nowomanorgasmpornridenomineeangeleagerfavoritesquirtingreleaseavn awardsquirtaward nomineeelegant angelbanglucky http://www.iphods.com/movie/586/squirt-gangbang/ http://www.iphods.com/videos/ec8b16b66ef008991c4b1c4f4d671d35.m4v http://www.iphods.com/clips/thumbs/ec8b16b66ef008991c4b1c4f4d671d35.jpg Squirt Gangbang 2008 AVN Award Nominee for Best Squirting Release. Elegant Angel proudly presents the eagerly anticipated SQUIRT GANGBANG, starring Sasha Grey and Chelsie Rae. This movie is a torrential downpour of epic proportions. Imagine all of your favorite squirting vixens together in one room, directing all of their focus on drenching one very lucky (and very wet) porn princess. If you think you've seen squirting before in Squirtwoman, Swallow My Squirt, and Squirt In My Gape, then think again. SQUIRT GANGBANG is arguably greatest squirt series of them all and a non ride of orgasmic eruptions. DO NOT MISS! 4.5 3 2009-07-11 Mature Adult Nowomanorgasmpornridenomineeangeleagerfavoritesquirtingreleaseavn awardsquirtaward nomineeelegant angelbanglucky http://www.iphods.com/movie/592/amateur-wonders-2/ http://www.iphods.com/videos/903b09f8926c0df6ea552a845f4b3d0b.m4v http://www.iphods.com/clips/thumbs/903b09f8926c0df6ea552a845f4b3d0b.jpg Amateur Wonders 2 2008 AVN Award Nominee for Best MILF Release. Nina gets DP Action and Squirts! Hot MILF starlet of the year Kristal Summers takes deep dick! More DP action with Ultra Sultry Kylie! Revenge Psychology - he fucks her then she fucks him! It's hot pegging and strap-on action! Lola's comeback to porn doing guys, she's missed that dick! Bonus Footage Included 3 3 2009-07-10 Mature Adult Nodickdeepguysevenpornfootnomineefucksawardfootagereleaseavn awardsquirtaward nomineemilfbonuskrisninarevenge http://www.iphods.com/movie/595/bi-bareback-orgy/ http://www.iphods.com/videos/ea609bac67d1b8b2fed627336d774642.m4v http://www.iphods.com/clips/thumbs/ea609bac67d1b8b2fed627336d774642.jpg Bi Bareback Orgy That slut Jessica Drew wants to spice things between her and boyfriend Farius Caine. She invites in young studs Rusty Stevenson, Kevin Rocha, Paul Black, and Johnny Walker. The pussy eating, cock sucking and raw cunt and ass fucking take over until everyone's desires are fulfilled. 5 3 2009-07-10 Mature Adult Nocockpussyyoungfuckingsuckingstudsveryblackslutboyfriendfilledcunt http://www.iphods.com/movie/742/butt-nurse-3/ http://www.iphods.com/videos/465064e0545e8cba69e12bcb8f45b4f4.m4v http://www.iphods.com/clips/thumbs/465064e0545e8cba69e12bcb8f45b4f4.jpg Butt Nurse 3 This time it's a house call. Once again this fellow is sick with tummy aches and the Dr. sent the nurses to help him out. It begins with a regular exam but when its time for a rectal temperature taking he decides to give the nurses a hard time. She warned him before this about a good spanking if he gave them a hard time. With out a word he is turned over, the nurse knees and gives him a hard bare bottom spanking until his bottom is bright red. Then his temperature is taken again. He is also given a rectal exam with one and 2 finger insertions. They find he is constipated so first he is given a castor oil enema. He once again gives the nurses a hard time. He is paddled this time with a large round wooden paddle. His bottom is then stretched and reamed open with inflatable butt plugs and dildos. When one nurse leaves the room the other decided she is going to teach this guy a lesson. She tells him he needs more anal lubricating and reaming. So she takes out a large strap-on dildo and gives him a reaming fucking 2 3 2009-04-17 Mature Adult Nospankingfuckingdeepanalbottombuttdildofingerbarepaddlecallenemalessonkneesdildosnursetakendecidepaddledlargeregulartableleaves http://www.iphods.com/movie/742/butt-nurse-3/ http://www.iphods.com/videos/9d00bbce7c1b1b1aa5e2e1635978bfcd.m4v http://www.iphods.com/clips/thumbs/9d00bbce7c1b1b1aa5e2e1635978bfcd.jpg Butt Nurse 3 This time it's a house call. Once again this fellow is sick with tummy aches and the Dr. sent the nurses to help him out. It begins with a regular exam but when its time for a rectal temperature taking he decides to give the nurses a hard time. She warned him before this about a good spanking if he gave them a hard time. With out a word he is turned over, the nurse knees and gives him a hard bare bottom spanking until his bottom is bright red. Then his temperature is taken again. He is also given a rectal exam with one and 2 finger insertions. They find he is constipated so first he is given a castor oil enema. He once again gives the nurses a hard time. He is paddled this time with a large round wooden paddle. His bottom is then stretched and reamed open with inflatable butt plugs and dildos. When one nurse leaves the room the other decided she is going to teach this guy a lesson. She tells him he needs more anal lubricating and reaming. So she takes out a large strap-on dildo and gives him a reaming fucking 5 3 2009-04-17 Mature Adult Nospankingfuckingdeepanalbottombuttdildofingerbarepaddlecallenemalessonkneesdildosnursetakendecidepaddledlargeregulartableleaves http://www.iphods.com/movie/742/butt-nurse-3/ http://www.iphods.com/videos/b1633c21a8ae1eb9117961df8d313372.m4v http://www.iphods.com/clips/thumbs/b1633c21a8ae1eb9117961df8d313372.jpg Butt Nurse 3 This time it's a house call. Once again this fellow is sick with tummy aches and the Dr. sent the nurses to help him out. It begins with a regular exam but when its time for a rectal temperature taking he decides to give the nurses a hard time. She warned him before this about a good spanking if he gave them a hard time. With out a word he is turned over, the nurse knees and gives him a hard bare bottom spanking until his bottom is bright red. Then his temperature is taken again. He is also given a rectal exam with one and 2 finger insertions. They find he is constipated so first he is given a castor oil enema. He once again gives the nurses a hard time. He is paddled this time with a large round wooden paddle. His bottom is then stretched and reamed open with inflatable butt plugs and dildos. When one nurse leaves the room the other decided she is going to teach this guy a lesson. She tells him he needs more anal lubricating and reaming. So she takes out a large strap-on dildo and gives him a reaming fucking 3 3 2009-04-17 Mature Adult Nospankingfuckingdeepanalbottombuttdildofingerbarepaddlecallenemalessonkneesdildosnursetakendecidepaddledlargeregulartableleaves http://www.iphods.com/movie/834/my-virtual-adulteress-adriana/ http://www.iphods.com/videos/9fd0502b745fe8374d83def455a0215a.m4v http://www.iphods.com/clips/thumbs/9fd0502b745fe8374d83def455a0215a.jpg My Virtual Adulteress - Adriana Your best friend's wife is a pain in the ass. She won't let him hang out with the guys or watch the games on TV anymore. Basically, she's a bitch. And you know why: your buddy's not getting the job done in the sack. You can help out. Be a sport and fuck HIS WIFE! Bang the shit out of this bitch and restore the balance of the universe! 2.5 3 2009-01-24 Mature Adult Nopainguyswifegamescallbang http://www.iphods.com/movie/900/single-tail-foot-whipping/ http://www.iphods.com/videos/b600ebc2f5a34233a5fa046432635285.m4v http://www.iphods.com/clips/thumbs/b600ebc2f5a34233a5fa046432635285.jpg Single-Tail Foot Whipping Before the vinegar and salt footbath, there's a detailed and methodical whipping. That's the way the fetish fulfillment flows in this movie and it flows well. Aside from the single-tail, you'll also see the hairdryer and fork utilized for maximum effect. These women came to have their need for punishment fulfilled, and they pay for it with a single-tail whipping of a lifetime. 2 3 2009-11-21 Mature Adult Nopunishmentfootlifefilledwhippinghairwhip http://www.iphods.com/movie/33/imperfect-angels-episode-5/ http://www.iphods.com/videos/e7c645cf915893be14a2f850bee08924.m4v http://www.iphods.com/clips/thumbs/e7c645cf915893be14a2f850bee08924.jpg Imperfect Angels Episode 5 "The Tangled Web of Fallen Doves" Samantha feels the heat and goes home for the weekend for a much needed rest, only to find out the heat turned up there, as well. Faye dreams of stepmom Maggie's steamy return, and Dana slowly seduces reluctant lesbian Lisa. Daisy continues her blackmail campaign when she exposes all matters to her friend Kurious. 4.5 2 2009-06-19 Mature Adult Nolesbiansteamycontinuesslowlycamp http://www.iphods.com/movie/33/imperfect-angels-episode-5/ http://www.iphods.com/videos/3f60095eb1c078cd2c40d9db0f680748.m4v http://www.iphods.com/clips/thumbs/3f60095eb1c078cd2c40d9db0f680748.jpg Imperfect Angels Episode 5 "The Tangled Web of Fallen Doves" Samantha feels the heat and goes home for the weekend for a much needed rest, only to find out the heat turned up there, as well. Faye dreams of stepmom Maggie's steamy return, and Dana slowly seduces reluctant lesbian Lisa. Daisy continues her blackmail campaign when she exposes all matters to her friend Kurious. 4.5 2 2009-06-19 Mature Adult Nolesbiansteamycontinuesslowlycamp http://www.iphods.com/movie/55/freaky-black-azz/ http://www.iphods.com/videos/3bd473effde84b9960a63ed76881e667.m4v http://www.iphods.com/clips/thumbs/3bd473effde84b9960a63ed76881e667.jpg Freaky Black Azz The freaky black azzes aren't limited to only the nubile young nymphets featured herein. These hot, chocolate-brown studs are packing a bit of junk in their own trunks. But who cares--as long as they're packing a thick hot rod with all pistons firing under the hood! Come; take vicarious pleasure as we watch these huge phat asses with natural black breasts pour on the charm with their equally horny male pursuers. This movie is only 2 hours, not 4 hours like box cover indicates. 4.5 2 2009-06-04 Mature Adult Noyoungpleasurestudsblackthickhugenaturalchocolateassesfeaturedbreastsfeaturemale http://www.iphods.com/movie/57/mutual-agreement/ http://www.iphods.com/videos/871e45e2a47a80e1fd1b95741aea0c24.m4v http://www.iphods.com/clips/thumbs/871e45e2a47a80e1fd1b95741aea0c24.jpg Mutual Agreement After a few exploratory smacks, the landlord, Reginald Blashford pulls Miss Simms, delinquent renter, across his knee for a class hand-spanking. She tolerates Reggie's groping hands on her tender bottom and his bizarre proclivities including dressing her up as a school girl and rifling through her underwear drawer. Nothing but the taste of the strap for this naked young nurse. Her Bottom glows despite her application of witch hazel. Reginald Blashford savors every sensual moment of this delightful session. They go over to the table for caning. Despite the pain and embarrassment, Miss Simms considers this to be "a mutually acceptable agreement". Bonus Footage Included 3.5 2 2009-06-04 Mature Adult Nospankingyounghandsschoolcaningfootbottomfootagepullsbonusnakedbizarrenursetable http://www.iphods.com/movie/58/new-resident-justine/ http://www.iphods.com/videos/537d4ad20de15be4c44b5000dcb7e8cc.m4v http://www.iphods.com/clips/thumbs/537d4ad20de15be4c44b5000dcb7e8cc.jpg New Resident Justine The new girl at school, Justine, is having trouble figuring out her lessons, so her teacher has stayed after school to try and help her. The problem is that Justine just can't seem to figure it out! He has to resort to corporal punishment to try and help her to understand! He uses a paddle and turns her backside bright red! Then, it's back to the lessons! 4.5 2 2009-06-04 Mature Adult Nopunishmentschoolpaddleorallessonteacher http://www.iphods.com/movie/80/risque-girls/ http://www.iphods.com/videos/ff158b0fafc687f75149b3be56f56610.m4v http://www.iphods.com/clips/thumbs/ff158b0fafc687f75149b3be56f56610.jpg Risque Girls Provocative, sultry, and exciting. Risque Girls from Australian website abbywinters.com breaks away from the standard girl-girl scenes to feature a unique all-girl THREESOME! Three stunning knockouts, three needing pussies, and multiple earth-shattering orgasms! Chloe and Larissa act as sexual muses for Kiki, obediently following her dirty orders while she eagerly watches on. It's not too long before Kiki's passion erupts and she squeezes herself between her friends' naked bodies, forcing them to pay her some much-needed, naughty attention. With some casual, flirty suggestions and a few light touches, the attraction between Kara and Keilyn is instant and obvious. Their passion, energy and enthusiasm deliver these two lovers orgasm after orgasm. Making love the way they want-no script, no instruction, and no direction, this video perfectly captures hot girl-girl action abbywinters.com is renowned for! 3 2 2009-05-21 Mature Adult Nogirlsexualorgasmorgasmsthreefriendsdirtynaughtyeagerlarissakeilynloverslovernakedwatchesends http://www.iphods.com/movie/85/class-of-99/ http://www.iphods.com/videos/fb054fcdd9a4c030a1e5d1978f8b6272.m4v http://www.iphods.com/clips/thumbs/fb054fcdd9a4c030a1e5d1978f8b6272.jpg Class Of '99 At the local college, Fiona Fines a star pupil has been laboriously painting her latest masterpiece. Miss Day, the head teacher enters in a fuss, and accuses her of stealing a watch. Fiona denies any knowledge of the event, but there is evidence stacked against her. The watch had been found in her locker. Mrs. Day soon looses patience with Fiona's denials and orders her to the common room for punishment. Therein follows the usual course set down for punishment curriculums. A sound hand spanking followed by a caning from the school rod. The cane leaves its customary welts and the young woman leaves in tears. Mrs. Day feels extremely guilty, though, when she finds out that the watch was indeed places in the locker by another person. In our second story Mr. Cooper finds the naughtiest girl in the school in the gentleman's toilets. Three times this has happened and all within an hour! She is sent to Mrs. Day's office for a severe caning, and of course receives a hand spanking on her curvy bottom. 4 2 2009-05-21 Mature Adult Nospankingpunishmentpainschoolcaningmasterwomanbottomthreesecondofficestoryextremeteacherleavessevere http://www.iphods.com/movie/93/frat-house-fuckfest-5/ http://www.iphods.com/videos/85f3b4927f2fce4b5e9ea9b3b616bc93.m4v http://www.iphods.com/clips/thumbs/85f3b4927f2fce4b5e9ea9b3b616bc93.jpg Frat House Fuckfest 5 Ain't no party like a PzY party! The foundation to a GREAT education! What I really learned in college! From beer bongs to blow jobs, we've got it all! These freaky freshmen get a real lesson! These pledges will do anything! Sexy co-eds with more than a book in their hands. These hot sorority sluts care only about getting their mouths full of cold beer and ...cock! If they gave out extra credit for having tight little bodies and hot little pussies these sluts would have graduated years ago! These girls all graduate Magna Cum Loudly! 2 2 2009-05-14 Mature Adult Nogirlssexytighthandspartypussiesanythingmouthlearnextrablowmouthslesson http://www.iphods.com/movie/106/english-discipline-series-the-riding-stable-two-corrected-fillies/ http://www.iphods.com/videos/f164fde6b89a806d59946293c2b18fe5.m4v http://www.iphods.com/clips/thumbs/f164fde6b89a806d59946293c2b18fe5.jpg English Discipline Series - The Riding Stable/Two Corrected Fillies This film is about Charlotte and Jane's time at their father's best friend's stable. The two very attractive girls soon fall foul of the rules and the man in charge takes the girls to the tack room for some over the knee hand spanking on their bare bottoms. This is followed by a hard stable strap and his leather belt to further ensure discipline in the stable yard. Finally, the girls are horrified to see him reach for a swishy cane which is used to good effect by leaving tramlines across their gorgeous bare bottoms. 4 2 2009-05-07 Mature Adult Nogirlsspankingleatherfinallyfilmverybottomusedbaretable http://www.iphods.com/movie/113/oh-no-theres-a-negro-in-my-wife-2/ http://www.iphods.com/videos/a1c9526fa0f214aaa8f5b29f8c6eae8c.m4v http://www.iphods.com/clips/thumbs/a1c9526fa0f214aaa8f5b29f8c6eae8c.jpg Oh No! There's A Negro In My Wife! 2 It's not easy for you to accept the fact that your wife is fucking a Negro. Her stretched out holes keep you from achieving an orgasm and the fried chicken crumbs on the bed just add insult to the injury. But, what troubles you most is watching her kiss your kids goodnight. If they only knew the disgusting black log those lips were wrapped around an hour ago. Maybe you should do them a favor and smother them as they sleep tonight. 4.5 2 2009-05-07 Mature Adult Nofuckingblackorgasmnightkissholeswifelipschick http://www.iphods.com/movie/115/bondage-squirters-3/ http://www.iphods.com/videos/c754db3e779e46a8868734f1c211d216.m4v http://www.iphods.com/clips/thumbs/c754db3e779e46a8868734f1c211d216.jpg Bondage Squirters 3 The hottest, sexiest and wettest bondage series continues with Maxine X and her squirting sluts in Bondage Squirters #3! This edition features the incomparable Jada Fire gushing and squirting hot pussy juice while helplessly bound spread-eagle and gagged. Sweet and sexy Jamie James is tied to the bondage sex chair and is made to cum to squirting orgasms over and over again. Maxine X also gets in on the wet action as she squirts buckets of pussy juice while bound in tight rope bondage. If you like to see the hottest, sexiest most beautiful squirters bound and forced to gush to wet orgasms, then this latest installment in the Bondage Squirters from Maxine X Productions is for you! 3.5 2 2009-05-07 Mature Adult Nopussysexybondagebeautifultightboundhottesttiedforcedorgasmorgasmsgaggedropehairsquirtingsexiestsquirtcontinuesspreadfeaturehelpless http://www.iphods.com/movie/118/by-appointment-only-8/ http://www.iphods.com/videos/6c995b38abdc115072a29d1d14bbb714.m4v http://www.iphods.com/clips/thumbs/6c995b38abdc115072a29d1d14bbb714.jpg By Appointment Only #8 Created by a Woman for Women. We're waiting for you! Share their desires, taste their passion, feel the sizzling excitement to their ultimate orgasms. Who couldn't resist watching two women tenderly caress each other's perky tits, and licking each other's pink, wet slits? Get ready to watch some of the most erotic lesbian scenes ever! 3 2 2009-04-30 Mature Adult Notitslesbianorgasmorgasmslickingultimate http://www.iphods.com/movie/121/young-girls-with-big-tits-volume-8-disc-1/ http://www.iphods.com/videos/67936d1b7272b7f8aee2324894880faa.m4v http://www.iphods.com/clips/thumbs/67936d1b7272b7f8aee2324894880faa.jpg Young Girls With Big Tits Volume 8 (Disc 1) 2 disc set. It's time to get your fill of fresh pussies and juicy jugs! Kagney Linn Karter, Ashlynn Brooke, Cassandra Calogera, Brandy Talore, Amy Ried, Sara Stone, Natasha Nice, and more busty young babes are here to rock your cock all night long. So watch their titties bounce all around as they grind their pussies all over your schlong. It doesn't get any better than fucking a hot young chick. Especially when she's got a pair of big hot tits! 3.5 2 2009-04-30 Mature Adult Nocockyoungtitsfuckingnicepussiesyour cocknightjuicyespeciallychicklynnbustypair http://www.iphods.com/movie/168/only-the-beautiful-2-disc-1/ http://www.iphods.com/videos/eff4f80d4f742e969d9f165cb42c7311.m4v http://www.iphods.com/clips/thumbs/eff4f80d4f742e969d9f165cb42c7311.jpg Only The Beautiful #2 (Disc 1) 2-Disc Special Edition. Come experience the sensation of fucking the most beautiful stars we have to offer. Sadie West, Jana Cova, Katsumi, Julia Bond, Lela Star, Paulina James, Bree Olson, Nikki Kane, Nika Noir, Memphis Monroe, Kiki Vidis, and Cindy Hope make this a top-notch cast that loves to fuck hard and fast. There's over four hours of fucking and sucking including some hot lesbian action. Beautiful girls and beautiful sex? You can't ask for more than that! 4.5 2 2009-03-26 Mature Adult Nogirllesbianfuckingsuckingexperiencesuckfourlovescindy http://www.iphods.com/movie/169/wish-to-be-hentai/ http://www.iphods.com/videos/00bbc279e4e429376096fb4e11a7b677.m4v http://www.iphods.com/clips/thumbs/00bbc279e4e429376096fb4e11a7b677.jpg Wish To Be Hentai This Japanese live action release is more fun than a barrel full of Hentai. In the first scene alone there's latex, urination, Riri creates some art with a very special part of her body, and flowers are planted in her flower! It only gets better from there in this crazy Asian import, so don't miss this amazing release from our friends at Crystal! 5 2 2009-03-26 Mature Adult Nobodyveryfriendsasianalonereleasejapaneseflowerlatexends http://www.iphods.com/movie/216/aubrey-taylor-pantyhose-2/ http://www.iphods.com/videos/d6a6ecd96abaf39b320a729e83fedf87.m4v http://www.iphods.com/clips/thumbs/d6a6ecd96abaf39b320a729e83fedf87.jpg Aubrey Taylor Pantyhose #2 4 Scenes from this Living Doll in Pantyhose who Loves to Tease! Alone POV! Wolford's! Point and Cum! Secretary Role Play Games! Shiny Tights! Sneaky Voyeur Peeks! Real Life Instructions! "Sorry, but you can fuck your hand for me" Lots of Nice with some Naughty Talk from this Tight Bodied All Star Tease!!! Playtime sweetheart, Aubrey Taylor, gives you hot views of her shapely legs in black Wolford, sheer crotch pantyhose under her short black dress. She stands directly over you as you see her round ass and trimmed snatch through the nylon. She pumps her fist lightly and asks "do you want to come on my ass?" She raises her dress up over her hips and places her sweet feet under your nose. "Do you want to fuck them?" Dress and black bra off, she squeezes her perfect tits as she holds the cameras she pans her lean body and rubs her nylon covered mound as she's getting hot teasing you. Now, she'll entice you to jack off with great up shots as she peels the hose off. Next, in a short pleated skirt, blouse and nu 4 2 2009-02-19 Mature Adult Nopussylovetitsdickbodynicewhitefeettonguelifelegsyour cockcameralovesnaughtycrotchsecretcuteshortcoveredalonegameslipsteasingpullsshoespumpspreadpantyhoseviewslowly,close,inches,nylon http://www.iphods.com/movie/220/real-girls-real-sex/ http://www.iphods.com/videos/264b354a01442d77ccec1725abc2858a.m4v http://www.iphods.com/clips/thumbs/264b354a01442d77ccec1725abc2858a.jpg Real Girls Real Sex "Real Girls Real Sex" stars big breasted Blaire initiating first-timers Keilyn and Larissa in two passionate girl-girl scenes. Blaire and Keilyn are tender and sensual to start but both quickly get very horny. These girls aren't shy to experiment. With lots of licking, sucking, fingering, and rimming in numerous positions with multiple electrifying orgasms, Blaire and Keilyn are a perfect match! The cameras aren't even ready when Blaire and Larissa start passionately kissing on the wooden floor. They soon move to the bedroom where Blaire takes charge of their steamy sex sessions. She directs Larissa to pleasure her exactly how and where she likes it. Both girls are full of energy as they erupt with several pulsating orgasms. Can't get enough of Blaire? Check out her bonus masturbation video with the mesmerizing Marigold. Watch their tits bounce in unison, listen to them dirty talk and then look out for their perfectly timed orgasms! 3 2 2009-02-17 Mature Adult Nogirltitssuckinghornypleasurevideosuckorgasmorgasmskissingcameradirtykisslickingfingersteamypositionslarissabedroomblairekeilynmasturbationpassionatebonuspositionfloor http://www.iphods.com/movie/224/disciplining-betty/ http://www.iphods.com/videos/431ca6e90e4253313f8978c9a8e56055.m4v http://www.iphods.com/clips/thumbs/431ca6e90e4253313f8978c9a8e56055.jpg Disciplining Betty Razor wants Betty to get better grades in college, but she can't seem to focus on that. She agrees to submit to discipline to help her concentrate, before realizing exactly what that means to her boyfriend. Familiar with "fun and games" style spanking, the feel of a hard and disciplinary hand on her silky smooth bottom comes as something of a shock! Razor spanks Betty hard and scolds her roundly. But Betty is a modern girl who resents such condescending treatment and doesn't scruple to let him know this. (Since this is a spanking video, her protests are ignored. Don't try this at home - unless you're dating a fellow spanking enthusiast!) After a not very gentle warm up, Betty's classic straight skirt is lifted and she treated to a brisk panty warming, during which the disciplinarian boyfriend barely pauses to notice the elegance of her silk lingerie combination. In due course, the voluptuous coed is stripped down to her dainty matching bra and panty, heels and hose ensemble, to receive the full measure of 2 2 2009-02-17 Mature Adult Nospankingyoungpunishmenthandspartybodywomanfilmvideoevendoesfetishlifeboyfriendspankedbottomfriendsspanksbrunettestylehighnaturalalwaysbarelearnhairpaddlegamesoralolderlady,classic,razor,lingerie,heels,breasts,lover,feature,ends,girlfriend,complete,queen,position,voluptuous,stripped,videos,free http://www.iphods.com/movie/267/woman-vs-machine/ http://www.iphods.com/videos/5ae27d2fbd71bc3d6dd7f88bc2be2177.m4v http://www.iphods.com/clips/thumbs/5ae27d2fbd71bc3d6dd7f88bc2be2177.jpg Woman Vs Machine Two girls plus one machine = One good fucking time! In Woman Vs Machine, the petite cutie Ashley Bands and buxom Kalissa Fellatio test their erotic abilities on a fucking machine! They are bound first and then strapped to this electronic joy to seek the ride of their lives! These black girls will be pleasure like never before proving that technology can really only improve our lives. 2.5 2 2009-01-15 Mature Adult Nogirlsboundwomanblackrideeroticashleytwo girls http://www.iphods.com/movie/271/spankorama/ http://www.iphods.com/videos/20248e335b17a3dfbe229572fc960d89.m4v http://www.iphods.com/clips/thumbs/20248e335b17a3dfbe229572fc960d89.jpg Spankorama In "Spankorama" the stories run continuously and in all the full beauty of the original digital recording. So, now, you can see the perfect, clear picture and hear the clean audio you've come to expect with our spanking movies. Even if you have already seen these clips on our members' site you'll enjoy revisiting them in their full rosy glory. The first story is entertains with a little holiday fun: Ashley Fires is an impish elf who ties-up, the stuffed animal Christmas toys she's supposed to wrap-up to load on Santa's sleigh. When Mrs. Claus catches Ashley in her naughty elf mischief, she delivers a Christmas Eve spanking the little elf won't soon forget! Story 2, also featuring Ashley, is a sensual tale of erotic spanking play between the sizzling, sexy blonde and Chelsea. Enticingly dressed in exquisite lingerie, Ashley is not shy concerning her exhibitionist tendencies! Ashley and Chelsea have a delicious sexual chemistry, as seen in the scenes they've done together. This was the first discovery of th 2.5 2 2009-01-09 Mature Adult Nolovespankingsexybeautifulpunishmentmistresssexualwomenplayblondedoesspankedbottombehindjulieerotictoysnaughtyeyessecretashleyofficesteamypaddlestorycleanlipschelsea'sstephanielingerielovely,movies,original,decide,paddled,stuffed,severe http://www.iphods.com/movie/272/strict-accounting/ http://www.iphods.com/videos/e83632503f60d4861b4b6d3527507811.m4v http://www.iphods.com/clips/thumbs/e83632503f60d4861b4b6d3527507811.jpg Strict Accounting The letter from the IRS stops just short of saying that the books are cooked and Chelsea's little book-keepers are in trouble, deep. Chelsea decides to make a "documentary" film, to help pay the penalty fee and Paris and Darling swiftly discover that they must participate or be fired. They sign their release forms, agreeing to be spanked. Darling goes first, squealing and struggling the whole time as Chelsea makes it sting. Paris is next, and Chelsea is just as stern. But poor Paris is really blameless! She gave Darling correct figures, but Darling lost them and just guessed when she filed the forms on Chelsea's behalf. Still, Darling sees an opportunity to lay all the blame on Paris. Chelsea believes Darling's fibs and orders Darling to spank Paris hard, first thing the next morning. Taken over Darling's knee, Paris pleads for mercy, but gets none as she suffers through hand and hairbrush. When Chelsea arrives to conduct a particularly embarrassing (for Paris) "examination" of the spankee's bottom 2 2 2009-01-09 Mature Adult Noleatherdeepfilmplayspankedbottomthickshorthairpaddlecoveredchelsea'shairbrushreleasepoortakendeciderevengebooks http://www.iphods.com/movie/272/strict-accounting/ http://www.iphods.com/videos/2f104cd2885c1f58236316df550ac611.m4v http://www.iphods.com/clips/thumbs/2f104cd2885c1f58236316df550ac611.jpg Strict Accounting The letter from the IRS stops just short of saying that the books are cooked and Chelsea's little book-keepers are in trouble, deep. Chelsea decides to make a "documentary" film, to help pay the penalty fee and Paris and Darling swiftly discover that they must participate or be fired. They sign their release forms, agreeing to be spanked. Darling goes first, squealing and struggling the whole time as Chelsea makes it sting. Paris is next, and Chelsea is just as stern. But poor Paris is really blameless! She gave Darling correct figures, but Darling lost them and just guessed when she filed the forms on Chelsea's behalf. Still, Darling sees an opportunity to lay all the blame on Paris. Chelsea believes Darling's fibs and orders Darling to spank Paris hard, first thing the next morning. Taken over Darling's knee, Paris pleads for mercy, but gets none as she suffers through hand and hairbrush. When Chelsea arrives to conduct a particularly embarrassing (for Paris) "examination" of the spankee's bottom 2.5 2 2009-01-09 Mature Adult Noleatherdeepfilmplayspankedbottomthickshorthairpaddlecoveredchelsea'shairbrushreleasepoortakendeciderevengebooks http://www.iphods.com/movie/272/strict-accounting/ http://www.iphods.com/videos/16be97b3f07a6703ab0d4fdc92dfad3a.m4v http://www.iphods.com/clips/thumbs/16be97b3f07a6703ab0d4fdc92dfad3a.jpg Strict Accounting The letter from the IRS stops just short of saying that the books are cooked and Chelsea's little book-keepers are in trouble, deep. Chelsea decides to make a "documentary" film, to help pay the penalty fee and Paris and Darling swiftly discover that they must participate or be fired. They sign their release forms, agreeing to be spanked. Darling goes first, squealing and struggling the whole time as Chelsea makes it sting. Paris is next, and Chelsea is just as stern. But poor Paris is really blameless! She gave Darling correct figures, but Darling lost them and just guessed when she filed the forms on Chelsea's behalf. Still, Darling sees an opportunity to lay all the blame on Paris. Chelsea believes Darling's fibs and orders Darling to spank Paris hard, first thing the next morning. Taken over Darling's knee, Paris pleads for mercy, but gets none as she suffers through hand and hairbrush. When Chelsea arrives to conduct a particularly embarrassing (for Paris) "examination" of the spankee's bottom 4 2 2009-01-09 Mature Adult Noleatherdeepfilmplayspankedbottomthickshorthairpaddlecoveredchelsea'shairbrushreleasepoortakendeciderevengebooks http://www.iphods.com/movie/272/strict-accounting/ http://www.iphods.com/videos/e559d065af77d33ed24fefce58beb66a.m4v http://www.iphods.com/clips/thumbs/e559d065af77d33ed24fefce58beb66a.jpg Strict Accounting The letter from the IRS stops just short of saying that the books are cooked and Chelsea's little book-keepers are in trouble, deep. Chelsea decides to make a "documentary" film, to help pay the penalty fee and Paris and Darling swiftly discover that they must participate or be fired. They sign their release forms, agreeing to be spanked. Darling goes first, squealing and struggling the whole time as Chelsea makes it sting. Paris is next, and Chelsea is just as stern. But poor Paris is really blameless! She gave Darling correct figures, but Darling lost them and just guessed when she filed the forms on Chelsea's behalf. Still, Darling sees an opportunity to lay all the blame on Paris. Chelsea believes Darling's fibs and orders Darling to spank Paris hard, first thing the next morning. Taken over Darling's knee, Paris pleads for mercy, but gets none as she suffers through hand and hairbrush. When Chelsea arrives to conduct a particularly embarrassing (for Paris) "examination" of the spankee's bottom 5 2 2009-01-09 Mature Adult Noleatherdeepfilmplayspankedbottomthickshorthairpaddlecoveredchelsea'shairbrushreleasepoortakendeciderevengebooks http://www.iphods.com/movie/275/rudely-interupted-a-bad-vacation/ http://www.iphods.com/videos/2d5957ea7e2d6d58d69f495e9cf27099.m4v http://www.iphods.com/clips/thumbs/2d5957ea7e2d6d58d69f495e9cf27099.jpg Rudely Interupted and A Bad Vacation Two different storylines help to make sure that every bad girl gets her good spanking. Julie plans a trip to Mexico for herself and Courtney. In an effort to economize, Julie books a vacation from hell. Once the two return, Courtney takes every awful memory out on poor, well-meaning Julie's behind. Julie Simone is a great spankee. She's got a shapely, generous behind and a gorgeous face with the most irresistible, pleading eyes we've ever seen. Courtney gets hers when she and Julie try to share the morning paper. Julie is naturally of a more serious disposition, so she just can't appreciate Courtney's constant comments on the comics. Pushed to the end of her limits, Julie takes Courtney over her knee. Courtney is soundly spanked over her jeans, then without them, then on her bare behind!!! 4 2 2009-01-09 Mature Adult Nospankingspankedbehindhelljulienaturaleyesbarestorypoorpositionbooks http://www.iphods.com/movie/275/rudely-interupted-a-bad-vacation/ http://www.iphods.com/videos/6b12bc0e4d789b181d18a1cc4929b59c.m4v http://www.iphods.com/clips/thumbs/6b12bc0e4d789b181d18a1cc4929b59c.jpg Rudely Interupted and A Bad Vacation Two different storylines help to make sure that every bad girl gets her good spanking. Julie plans a trip to Mexico for herself and Courtney. In an effort to economize, Julie books a vacation from hell. Once the two return, Courtney takes every awful memory out on poor, well-meaning Julie's behind. Julie Simone is a great spankee. She's got a shapely, generous behind and a gorgeous face with the most irresistible, pleading eyes we've ever seen. Courtney gets hers when she and Julie try to share the morning paper. Julie is naturally of a more serious disposition, so she just can't appreciate Courtney's constant comments on the comics. Pushed to the end of her limits, Julie takes Courtney over her knee. Courtney is soundly spanked over her jeans, then without them, then on her bare behind!!! 4 2 2009-01-09 Mature Adult Nospankingspankedbehindhelljulienaturaleyesbarestorypoorpositionbooks http://www.iphods.com/movie/275/rudely-interupted-a-bad-vacation/ http://www.iphods.com/videos/48e26aa383fe4f82de3911dbcbcf7d87.m4v http://www.iphods.com/clips/thumbs/48e26aa383fe4f82de3911dbcbcf7d87.jpg Rudely Interupted and A Bad Vacation Two different storylines help to make sure that every bad girl gets her good spanking. Julie plans a trip to Mexico for herself and Courtney. In an effort to economize, Julie books a vacation from hell. Once the two return, Courtney takes every awful memory out on poor, well-meaning Julie's behind. Julie Simone is a great spankee. She's got a shapely, generous behind and a gorgeous face with the most irresistible, pleading eyes we've ever seen. Courtney gets hers when she and Julie try to share the morning paper. Julie is naturally of a more serious disposition, so she just can't appreciate Courtney's constant comments on the comics. Pushed to the end of her limits, Julie takes Courtney over her knee. Courtney is soundly spanked over her jeans, then without them, then on her bare behind!!! 5 2 2009-01-09 Mature Adult Nospankingspankedbehindhelljulienaturaleyesbarestorypoorpositionbooks http://www.iphods.com/movie/275/rudely-interupted-a-bad-vacation/ http://www.iphods.com/videos/dbc887c4320a1a3117b25f230729ddc5.m4v http://www.iphods.com/clips/thumbs/dbc887c4320a1a3117b25f230729ddc5.jpg Rudely Interupted and A Bad Vacation Two different storylines help to make sure that every bad girl gets her good spanking. Julie plans a trip to Mexico for herself and Courtney. In an effort to economize, Julie books a vacation from hell. Once the two return, Courtney takes every awful memory out on poor, well-meaning Julie's behind. Julie Simone is a great spankee. She's got a shapely, generous behind and a gorgeous face with the most irresistible, pleading eyes we've ever seen. Courtney gets hers when she and Julie try to share the morning paper. Julie is naturally of a more serious disposition, so she just can't appreciate Courtney's constant comments on the comics. Pushed to the end of her limits, Julie takes Courtney over her knee. Courtney is soundly spanked over her jeans, then without them, then on her bare behind!!! 4 2 2009-01-09 Mature Adult Nospankingspankedbehindhelljulienaturaleyesbarestorypoorpositionbooks http://www.iphods.com/movie/276/chelsea-spankskailee-berlin/ http://www.iphods.com/videos/31d919bef78118d86eb84424b9a6472e.m4v http://www.iphods.com/clips/thumbs/31d919bef78118d86eb84424b9a6472e.jpg Chelsea Spanks:Kailee and Berlin Kailee's Spanking: Kailee came to us while visiting friends here in Southern California. She's a former Real Spankings model and since they've stopped shooting new material, she's been getting her spanking fixes with the various other spanking production companies, ours included. And, lucky for us! A truly experienced and truly enthusiastic spanking aficionado, Kailee could take all that I could dish out and any of you familiar with my spanking style knows that's quite a bit! We started with a hand spanking, but soon moved on to the first of six implements. Even though I dish out a diabolical hand spanking, I recognized pretty quickly that Kailee was up for more...a LOT more! By the time her half hour spanking concluded, Kailee had been paddled with my leather paddle, spanked with a hairbrush, strapped with a black leather strap, paddled (again!) with a VERY large wooden paddle and finally caned with my little twisted cane. That little cane is a lot stingier than it looks! Berlin's Spanking: I don't oft 5 2 2009-01-09 Mature Adult Noyoungnastyleatherexperiencefinallyevenprettyspankedfriendsstyleberlinshortsurpriseangelusedhairpaddleexperiencedsmokehairbrushshootpaddledlargeluckytruly http://www.iphods.com/movie/276/chelsea-spankskailee-berlin/ http://www.iphods.com/videos/bd74f245352feb649de67c5791407236.m4v http://www.iphods.com/clips/thumbs/bd74f245352feb649de67c5791407236.jpg Chelsea Spanks:Kailee and Berlin Kailee's Spanking: Kailee came to us while visiting friends here in Southern California. She's a former Real Spankings model and since they've stopped shooting new material, she's been getting her spanking fixes with the various other spanking production companies, ours included. And, lucky for us! A truly experienced and truly enthusiastic spanking aficionado, Kailee could take all that I could dish out and any of you familiar with my spanking style knows that's quite a bit! We started with a hand spanking, but soon moved on to the first of six implements. Even though I dish out a diabolical hand spanking, I recognized pretty quickly that Kailee was up for more...a LOT more! By the time her half hour spanking concluded, Kailee had been paddled with my leather paddle, spanked with a hairbrush, strapped with a black leather strap, paddled (again!) with a VERY large wooden paddle and finally caned with my little twisted cane. That little cane is a lot stingier than it looks! Berlin's Spanking: I don't oft 2.5 2 2009-01-09 Mature Adult Noyoungnastyleatherexperiencefinallyevenprettyspankedfriendsstyleberlinshortsurpriseangelusedhairpaddleexperiencedsmokehairbrushshootpaddledlargeluckytruly http://www.iphods.com/movie/276/chelsea-spankskailee-berlin/ http://www.iphods.com/videos/1ef28a5e54b407d52790a3b1b7ed88b7.m4v http://www.iphods.com/clips/thumbs/1ef28a5e54b407d52790a3b1b7ed88b7.jpg Chelsea Spanks:Kailee and Berlin Kailee's Spanking: Kailee came to us while visiting friends here in Southern California. She's a former Real Spankings model and since they've stopped shooting new material, she's been getting her spanking fixes with the various other spanking production companies, ours included. And, lucky for us! A truly experienced and truly enthusiastic spanking aficionado, Kailee could take all that I could dish out and any of you familiar with my spanking style knows that's quite a bit! We started with a hand spanking, but soon moved on to the first of six implements. Even though I dish out a diabolical hand spanking, I recognized pretty quickly that Kailee was up for more...a LOT more! By the time her half hour spanking concluded, Kailee had been paddled with my leather paddle, spanked with a hairbrush, strapped with a black leather strap, paddled (again!) with a VERY large wooden paddle and finally caned with my little twisted cane. That little cane is a lot stingier than it looks! Berlin's Spanking: I don't oft 4.5 2 2009-01-09 Mature Adult Noyoungnastyleatherexperiencefinallyevenprettyspankedfriendsstyleberlinshortsurpriseangelusedhairpaddleexperiencedsmokehairbrushshootpaddledlargeluckytruly http://www.iphods.com/movie/288/teen-anal-pounding-3/ http://www.iphods.com/videos/0dcc30dd7bf5e753c49f850b1b8ce6a8.m4v http://www.iphods.com/clips/thumbs/0dcc30dd7bf5e753c49f850b1b8ce6a8.jpg Teen Anal Pounding #3 Who doesn't like butt sex? Or more precisely, who doesn't like watching foxy teenage girls getting bamboozled into giving up their smooth young asses for a brutal pounding? Nobody, that's who! TEEN ANAL POUNDING abandons all subtlety in favor of unrepentant backdoor onslaught. You'll see these slutty teenagers take to anal like sluts to fucking! They'll even give you a blowjob before and after you pound their ass! Ahh, there's nothing like ATM! One little butt slut even has a threesome where she gets filled up with a double penetration! 4.5 2 2009-12-31 Mature Adult Noyoungfuckingbodydoubleevenanaldoesslutthreebuttpoundingfilleddoorblowassespenetration http://www.iphods.com/movie/319/tag-team-strap-on/ http://www.iphods.com/videos/f35ba1d7a65c6abb67cf4a46633d971d.m4v http://www.iphods.com/clips/thumbs/f35ba1d7a65c6abb67cf4a46633d971d.jpg Tag-Team Strap-On One woman in the throes of a snarl is bad enough. Two teamed up on the rag, or whatever turns them evil, is all it takes for an unbridled afternoon of mayhem. As a result, mankind is doomed, sucking up to these banshees. Banks are closing, and other sacred institutions we hold neat and dear are crumbling. Forget what you've read as an excuse. It's because men are now taking it up the ass. In this hot strap-on film, real life couples welcome a domme into their relationship and the result is one pain in the ass for dear old hubby. These men are completely dominated, as two angry bitches with big rubber cocks violate their tender assholes. 5 2 2009-12-12 Mature Adult Nocockpainsuckingwomanfilmsuckcockslifeholesassholesbitchescouplesassholerubbercompletelycouplecomplete http://www.iphods.com/movie/321/intimate-moments/ http://www.iphods.com/videos/61ad58723b23ded902406463f7c728d1.m4v http://www.iphods.com/clips/thumbs/61ad58723b23ded902406463f7c728d1.jpg Intimate Moments Watch as each girl invites us in to witness one of the most intimate moments a person can experience - masturbation to orgasm. This is the real thing, no artifice, no fakery. Six girls, each alone in their rooms, no toys, doing it the only way they know how, their way, so that they can reach genuine orgasm. 3.5 2 2009-12-05 Mature Adult Noexperienceorgasmtoysintimatealonemasturbation http://www.iphods.com/movie/321/intimate-moments/ http://www.iphods.com/videos/60c34f21c98adea24efb2205a29c884a.m4v http://www.iphods.com/clips/thumbs/60c34f21c98adea24efb2205a29c884a.jpg Intimate Moments Watch as each girl invites us in to witness one of the most intimate moments a person can experience - masturbation to orgasm. This is the real thing, no artifice, no fakery. Six girls, each alone in their rooms, no toys, doing it the only way they know how, their way, so that they can reach genuine orgasm. 2.5 2 2009-12-05 Mature Adult Noexperienceorgasmtoysintimatealonemasturbation http://www.iphods.com/movie/341/amazing-chubby-trilogy-hefty-horny/ http://www.iphods.com/videos/b5b53e2ff7ee54c47af3d7c07b84f2a0.m4v http://www.iphods.com/clips/thumbs/b5b53e2ff7ee54c47af3d7c07b84f2a0.jpg Amazing Chubby Trilogy - Hefty and Horny Alright chubby chick chasers, here's your chance to appreciate some ultra-hot and definitely chubby cum guzzlers! They're hungry for cock! These hefty mama's know what it takes to make you shoot your load, and they'll swallow every bit! We've got big girls and really big girls with an insatiable appetite for men and their sweet, sweet man milk! If you go for the plump, tattooed type, or maybe the chunky cum lover with those thick, wet lips, then this movie is perfect for you. So get comfortable and enjoy these sweet donut darlings! 4.5 2 2009-11-20 Mature Adult Nothicklipsinsatiablechicklovershoottable http://www.iphods.com/movie/370/dark-meat-lovers-2/ http://www.iphods.com/videos/18da89b56d9213e9ecc4ba8d15e2b83a.m4v http://www.iphods.com/clips/thumbs/18da89b56d9213e9ecc4ba8d15e2b83a.jpg Dark Meat Lovers 2 Nasty Blonde newcummer Tianna has a succulent punanny and loves ridin the bologna pony! Tera Dice is freaky ho with a huge bum and a puffy cam-toe who is in desperate need of the chocolate snake! Leah Livingston is an all natural Midwestern gal who is ready to find out how the real big dick playaz on the West Coast get down! Naughty redheaded Orange County native Daisy Belle thought she could handle a rough ride, but she didn't know how hard the brothaz in the San Fernando Valley rock that pussy! Brittany Angel has a dark secret that she hopes her drunken hillbilly dad back home in Kentucky doesn't find out about. Can you guess what it is? Surprise, Its BLACK COCK!!! 4.5 2 2009-10-30 Mature Adult Nopussynastydickblackblonderideloveshugenaturalnaughtysecretsurpriseangeldarkchocolatebrittany http://www.iphods.com/movie/370/dark-meat-lovers-2/ http://www.iphods.com/videos/e2a9024fc779df8e8d209c1487d095f6.m4v http://www.iphods.com/clips/thumbs/e2a9024fc779df8e8d209c1487d095f6.jpg Dark Meat Lovers 2 Nasty Blonde newcummer Tianna has a succulent punanny and loves ridin the bologna pony! Tera Dice is freaky ho with a huge bum and a puffy cam-toe who is in desperate need of the chocolate snake! Leah Livingston is an all natural Midwestern gal who is ready to find out how the real big dick playaz on the West Coast get down! Naughty redheaded Orange County native Daisy Belle thought she could handle a rough ride, but she didn't know how hard the brothaz in the San Fernando Valley rock that pussy! Brittany Angel has a dark secret that she hopes her drunken hillbilly dad back home in Kentucky doesn't find out about. Can you guess what it is? Surprise, Its BLACK COCK!!! 4.5 2 2009-10-30 Mature Adult Nopussynastydickblackblonderideloveshugenaturalnaughtysecretsurpriseangeldarkchocolatebrittany http://www.iphods.com/movie/436/playtimes-nudes-presents-carli-banks/ http://www.iphods.com/videos/178f6a120b0f998a6081c0ee6c46fbc0.m4v http://www.iphods.com/clips/thumbs/178f6a120b0f998a6081c0ee6c46fbc0.jpg Playtimes Nudes Presents - Carli Banks Everyone's Favorite Sweetheart returns! Carli's Come Back and She's Got a Big Surprise! Her First Anal Ever! Anal Play with Fingers and Vibrator. Love Doll! Instructions! Up-close and Personal "Alone Time." Pussy Play with Toys and Fingers! Not Mean, Just A Non-Stop Stream of Sweet, Coaxing, Teasing J/O Talk! Carli will Seduce You and Drain You Dry! Don't Miss Carli's Anal Premier for Playtime! Carli's back and she's not mean like last time - she's sweet and sensual, posing in her tan stockings and tight white top. "Are you stroking your penis right now?," she asks, warning you not to cum too soon. Lots of up skirt views of her slim 20-year-old body and nearly bald kitty. Stripping to black panties, she spreads her legs wide. "Does that get your dick nice and hard?" she teases. JO commands as she shows off her full, natural breasts and rubs her tasty muffin. "Are you getting ready to squirt it all over my body? You're so fucking naughty." Carli pulls out a long purple vibrator, licking and sucking it. She ba 4.5 2 2009-09-16 Mature Adult Noyoungtitstightdicksuckingniceverysuckplayblackorgasmdoeswhitelegsbottomridelickingtoyshighnaturalnaughtysurprisealonemassivefavoritecleanteasingbedroomblowpullssquirt,panties,asshole,carli,fingers,lingerie,kitty,stockings,breasts,vibrator,spread,naked,couple,view,bang,close,clit http://www.iphods.com/movie/460/milf-frenzy/ http://www.iphods.com/videos/9d6b51c9925aca9a60f058acd07ee7db.m4v http://www.iphods.com/clips/thumbs/9d6b51c9925aca9a60f058acd07ee7db.jpg MILF Frenzy It is a frenzy of MILF and you are invited as the moms from next door gets butt fucked time and time again. Who knew mom could fuck like a champ; some might even say she is better at fucking than someone half her age! These MILFs are worked up and ready to get pounded by the fountain of youth. 3 2 2009-09-04 Mature Adult Nofuckingevenbuttmomsmilfmilfs http://www.iphods.com/movie/462/my-first-black-cock-7-milf-edition/ http://www.iphods.com/videos/81082b9d78ab615e139944ac441852f7.m4v http://www.iphods.com/clips/thumbs/81082b9d78ab615e139944ac441852f7.jpg My First Black Cock 7 - MILF Edition I was watching a really hot porn DVD with this hot Black guy and his huge cock fucking every chick in sight! I'd never seen anything that big, or that stayed so hard for so long. I had to try it. So I did! Girls, until you've had a massive Black rod up your pussy or your ass- you ain't had nothin' yet. And those Black studs really love us moms, we love to fuck and so do they. So I waited a long time for my first Black cock, but it was worth it... every time my old man goes on a business trip, I go on a 'Black cock' trip! Once you try it, you'll be Black Cockin' for good... and that's real good! 4 2 2009-09-03 Mature Adult Nopussyfuckingstudsverypornanythinghugemassivechickmomsbusiness http://www.iphods.com/movie/463/nina-hartley-milf-trainer/ http://www.iphods.com/videos/da30841daad0d9740bbb93c21f8103f7.m4v http://www.iphods.com/clips/thumbs/da30841daad0d9740bbb93c21f8103f7.jpg Nina Hartley: MILF Trainer Blu-Ray Version. Get out a pencil and paper, because porn legend Nina Hartley is about to school you in the ways of the MILF. Watch her and her MILF crew fuck and suck a cock like it should be! Nina is the fuck of a lifetime! Watch her supple ass bounce a rock hard cock! 3 2 2009-09-03 Mature Adult Nocockschoolsuckrock hardhard cockmilfnina http://www.iphods.com/movie/466/house-of-ass-9/ http://www.iphods.com/videos/67902c347ca1d98d9f571a5dff8e6f03.m4v http://www.iphods.com/clips/thumbs/67902c347ca1d98d9f571a5dff8e6f03.jpg House Of Ass 9 Lord Byron invites you into HOUSE OF ASS #9 where some of the finest asses anywhere entice you to jerk yourself silly. These gals find themselves impaled on Tom's tireless c*ck in this all-anal ass slam from Tom Byron Pictures. Get a towel and ready! 4.5 2 2009-08-29 Mature Adult Noanalasses http://www.iphods.com/movie/466/house-of-ass-9/ http://www.iphods.com/videos/7ad51f5cee7fbb57604073a7f1c39a73.m4v http://www.iphods.com/clips/thumbs/7ad51f5cee7fbb57604073a7f1c39a73.jpg House Of Ass 9 Lord Byron invites you into HOUSE OF ASS #9 where some of the finest asses anywhere entice you to jerk yourself silly. These gals find themselves impaled on Tom's tireless c*ck in this all-anal ass slam from Tom Byron Pictures. Get a towel and ready! 2 2 2009-08-29 Mature Adult Noanalasses http://www.iphods.com/movie/468/transworld-5/ http://www.iphods.com/videos/0f06ebe09c82ee848c3952ba175139c5.m4v http://www.iphods.com/clips/thumbs/0f06ebe09c82ee848c3952ba175139c5.jpg Transworld 5 3 Vision Entertainment continues the hot Transworld series with the best of she-male talent in Transworld 5. Sucking, fucking, and craving cum filled cocks that is guaranteed to be a sticky delight. Director Ludo Perre knows exactly what you want and he delivers. 2 2 2009-08-28 Mature Adult Nofuckingsuckingcocksfilledcravingdirectorcontinuesmale http://www.iphods.com/movie/468/transworld-5/ http://www.iphods.com/videos/4ec0d96c57056ca506be1fcee37381af.m4v http://www.iphods.com/clips/thumbs/4ec0d96c57056ca506be1fcee37381af.jpg Transworld 5 3 Vision Entertainment continues the hot Transworld series with the best of she-male talent in Transworld 5. Sucking, fucking, and craving cum filled cocks that is guaranteed to be a sticky delight. Director Ludo Perre knows exactly what you want and he delivers. 4 2 2009-08-28 Mature Adult Nofuckingsuckingcocksfilledcravingdirectorcontinuesmale http://www.iphods.com/movie/472/splosh-fest/ http://www.iphods.com/videos/e6a792bba08fe4788961db0c908bc954.m4v http://www.iphods.com/clips/thumbs/e6a792bba08fe4788961db0c908bc954.jpg Splosh Fest If you like your women beautiful, muscular, nude and covered in food then this is the video for you! You guys into Splosh videos know what I am talking about. Women dipping their beautiful bare feet into Jell-O or pouring Tapioca on their tushy. Bathing themselves in food. It is hot and it is here in Goddess Heather's first Splosh video - "Splosh Fest!" Watch as Goddess Heather (with ten chains hanging from her beautiful pussy rings) covers herself in colorful food. The viewer gets a real glimpse of Goddess Heather's personality and sense of humor plus there is nothing quite like watching a fresh cherry pie covered with whipping cream gushing out from between a set of beautiful thighs. Packing your pussy with pie, now that's what makes this country great! Now that's entertainment!! 4.5 2 2009-08-28 Mature Adult Noguysvideofeethighwhippingbarecoveredwhipcreamfestgoddessviewvideos http://www.iphods.com/movie/480/deep-inside-samantha-fox/ http://www.iphods.com/videos/23cb98a734f8c5b99d15d92e77eadc63.m4v http://www.iphods.com/clips/thumbs/23cb98a734f8c5b99d15d92e77eadc63.jpg Deep Inside Samantha Fox Samantha Fox was born in NYC in the 1950's. Throughout her younger years she became heavily involved in dance, eventually dancing as a professional. She is an intense and sizzling brunette, with a gorgeous body. Her first adult role was in the Video-X-Pix hit, Bad Penny (1978), directed by Chuck Vincent. After this, she began to take on lead roles as an adult starlet and shortly after entering the industry Samantha was already on her way to legendary status. She was indeed a true gem of the age. Her on screen chemistry and scenes with performer/husband, Bobby Astyr, were among the most entertaining of all time. This collection of Samantha Fox's most erotic scenes from the VXP vault is a must have for any serious collector of Golden Age Erotica. This is vintage porn at it's finest. 3.5 2 2009-08-27 Mature Adult Nobodyvideoevenpornintensebrunetteeroticshorthusbandadultcollectiondancingeventually http://www.iphods.com/movie/482/ball-in-the-family/ http://www.iphods.com/videos/939180f91b9d079d312f9809a80308f0.m4v http://www.iphods.com/clips/thumbs/939180f91b9d079d312f9809a80308f0.jpg Ball In The Family Itchy and Eatit Bonker have a nice house in Queens, a very beautiful daughter who is a nymphomaniac, a mooching son-in-law who is hung like horse, and a fondness for fooling around every chance they get. Come spend a day with them as they try to keep it, Ball in the Family. 4.5 2 2009-08-27 Mature Adult Nonicedaughterballqueen http://www.iphods.com/movie/483/you-make-me-wet/ http://www.iphods.com/videos/263747071c126dc69880ad05bf8d1d2f.m4v http://www.iphods.com/clips/thumbs/263747071c126dc69880ad05bf8d1d2f.jpg You Make Me Wet Love and jealously make strange bedfellows. The fur flies and the juices run rampant when Maude and Tracy combine their fleshly pleasures in strange, unusual, and exciting ways - but that doesn't stop them from venting their lustful desires with other girls and guys. The sensual flames burn brightly, exploding into an all-out conflagration when the two girls get together with a mutual boyfriend to experience the ultimate fulfillment. 2 2 2009-08-27 Mature Adult Nogirlsloveexperienceguysdoesboyfriendultimatetwo girls http://www.iphods.com/movie/483/you-make-me-wet/ http://www.iphods.com/videos/de56e18f8cc1f6781c3968ea5c063e5d.m4v http://www.iphods.com/clips/thumbs/de56e18f8cc1f6781c3968ea5c063e5d.jpg You Make Me Wet Love and jealously make strange bedfellows. The fur flies and the juices run rampant when Maude and Tracy combine their fleshly pleasures in strange, unusual, and exciting ways - but that doesn't stop them from venting their lustful desires with other girls and guys. The sensual flames burn brightly, exploding into an all-out conflagration when the two girls get together with a mutual boyfriend to experience the ultimate fulfillment. 4 2 2009-08-27 Mature Adult Nogirlsloveexperienceguysdoesboyfriendultimatetwo girls http://www.iphods.com/movie/490/sunny-lane-anal/ http://www.iphods.com/videos/b97ef386627c4f7e3e261be8011986a8.m4v http://www.iphods.com/clips/thumbs/b97ef386627c4f7e3e261be8011986a8.jpg Sunny Lane Anal 2009 AVN Award Winner for Best Anal Scene and 2009 AVN Award Winner for Best Big Butt ReleaseBig Wet Asses, the winner of AVN's coveted Best Anal Themed Series award for 2006, 2007, and 2008, is back! Elegant Angel is delighted to announce that porn superstar, Sunny Lane, stars in the thirteenth edition of the critically acclaimed series, performing in her very first, highly anticipated anal scene, alongside another stellar assemblage of voluptuous superstars. The curvaceous and fair-haired beauty, Sunny, performs with former AVN, male performer of the year, Manuel Ferrara. The scene is thirty five minutes of scorching hot, passionate sex, featuring plenty of balls to the wall, hardcore anal. The on set chemistry between Sunny and Manuel is electric. "I'm so happy," said Sunny. "It was such a great scene, and I was so excited and turned on. This scene was all I could think about last night. I had definitely been practicing over the past couple of weeks while thinking about Manuel's big cock penetrating my ass 4.5 2 2009-08-25 Mature Adult Nogirlsballsanalhardcoreorgasmorgasmspornwhitebuttnightkellyhighawardwinnerangelhaircallreleasehappyavn awardasseselegant angelpassionatehardcore analcouplesuperstarmaleballvoluptuousaward winner http://www.iphods.com/movie/490/sunny-lane-anal/ http://www.iphods.com/videos/3f43ee62fbff5b766752ddb2affb8cd1.m4v http://www.iphods.com/clips/thumbs/3f43ee62fbff5b766752ddb2affb8cd1.jpg Sunny Lane Anal 2009 AVN Award Winner for Best Anal Scene and 2009 AVN Award Winner for Best Big Butt ReleaseBig Wet Asses, the winner of AVN's coveted Best Anal Themed Series award for 2006, 2007, and 2008, is back! Elegant Angel is delighted to announce that porn superstar, Sunny Lane, stars in the thirteenth edition of the critically acclaimed series, performing in her very first, highly anticipated anal scene, alongside another stellar assemblage of voluptuous superstars. The curvaceous and fair-haired beauty, Sunny, performs with former AVN, male performer of the year, Manuel Ferrara. The scene is thirty five minutes of scorching hot, passionate sex, featuring plenty of balls to the wall, hardcore anal. The on set chemistry between Sunny and Manuel is electric. "I'm so happy," said Sunny. "It was such a great scene, and I was so excited and turned on. This scene was all I could think about last night. I had definitely been practicing over the past couple of weeks while thinking about Manuel's big cock penetrating my ass 3 2 2009-08-25 Mature Adult Nogirlsballsanalhardcoreorgasmorgasmspornwhitebuttnightkellyhighawardwinnerangelhaircallreleasehappyavn awardasseselegant angelpassionatehardcore analcouplesuperstarmaleballvoluptuousaward winner http://www.iphods.com/movie/498/goddess-alexia-party-time-foot-preparation/ http://www.iphods.com/videos/1fb1c05502bfcff7ddbef8f9cabae598.m4v http://www.iphods.com/clips/thumbs/1fb1c05502bfcff7ddbef8f9cabae598.jpg Goddess Alexia - Party Time Foot Preparation Do you think you can handle the cruelty of Mistress Alexia? Watch as Mistress Alexia prepares herself for a fun evening out on the town. But guess what? Her pathetic slave isn't allowed to come along. Of course, Mistress Alexia makes him watch and envy her as she gets ready to leave, making him lay beneath her feet! 3 2 2009-08-21 Mature Adult Noslavemistressfeet http://www.iphods.com/movie/499/queens-of-trample/ http://www.iphods.com/videos/604b51ad605cd406ed812700e7d13afc.m4v http://www.iphods.com/clips/thumbs/604b51ad605cd406ed812700e7d13afc.jpg Queens Of Trample For the first time ever the MOST INTENSE, MOST BEAUTIFUL and MOST BRUTAL TRAMPLING MISTRESS are on one video. SIX VICIOUS VIXENS! TWELVE FEROCIOUS FEET in nonstop STOMPING ACTION! Shot during tapings of "Playboy Sexcetera" with SCOTT POTASNIK (host of the Playboy Sexcetera show), this video takes you both into the action and behind the scenes. The action begins with an incredible DOUBLE TRAMPLE of Slave Jonesy by the certifiably DEMENTED MISTRESS SANDRA ROMAINE and BIG TITTED BLONDE MISTRESS BARBARA SUMMERS. Their HIGH HEELS DIG DEEP into the slave's flesh as they stream VERBAL ABUSE. Then the ladies go solo. First Barbara takes her time crushing him and making him SUCK HER SPIKED HEEL, then Sandra goes to town, jumping on Jonsey and actually JOGGING ON HIM! Scott is encouraged to see how it feels to be trampled. BIG MISTAKE! Sandra and Barbara make him scream and leave him with a lasting and painful impression! Sandra and Barbara then team up again to TRAMPLE Slave Tom. He thinks he's a tough guy, but 4 2 2009-08-21 Mature Adult Nobeautifulpainslaveladiesbodymistressdeepdoublevideoplayblondefeetbehindintensehighhugejoinbarecreamskinfirst timepoormistressesshoesslavesheelsfloorincredible http://www.iphods.com/movie/501/bisex-party-vol-2-the-swingers-club/ http://www.iphods.com/videos/e3fec834859484979efb07c160412cb4.m4v http://www.iphods.com/clips/thumbs/e3fec834859484979efb07c160412cb4.jpg BiSex Party Vol. 2 - The Swingers Club The leading MMF studio in the world, Eromaxx, presents another bisexual tornado of cock and cunt that will leave you shaking in the knees. Dozens upon dozens of good looking guys and girls get it on in every conceivable way with whomever they want! ANYTHING goes with this wild and horny hoard of hotties that are down to fuck, suck, eat, rim, and shoot some hot loads of cum on whoever comes their way! There's so much insane bisex action jam-packed into this two-hour film that even after you've seen it, you still won't believe it! 5 2 2009-08-21 Mature Adult Nohornysexualfilmguyswildevenanythingbisexualhottiescuntshootknees http://www.iphods.com/movie/501/bisex-party-vol-2-the-swingers-club/ http://www.iphods.com/videos/2654e22959e12449a7565f7fba8d6fcc.m4v http://www.iphods.com/clips/thumbs/2654e22959e12449a7565f7fba8d6fcc.jpg BiSex Party Vol. 2 - The Swingers Club The leading MMF studio in the world, Eromaxx, presents another bisexual tornado of cock and cunt that will leave you shaking in the knees. Dozens upon dozens of good looking guys and girls get it on in every conceivable way with whomever they want! ANYTHING goes with this wild and horny hoard of hotties that are down to fuck, suck, eat, rim, and shoot some hot loads of cum on whoever comes their way! There's so much insane bisex action jam-packed into this two-hour film that even after you've seen it, you still won't believe it! 2 2 2009-08-21 Mature Adult Nohornysexualfilmguyswildevenanythingbisexualhottiescuntshootknees http://www.iphods.com/movie/502/naked-olympics/ http://www.iphods.com/videos/b40360791535b42dbf1637f7693a3822.m4v http://www.iphods.com/clips/thumbs/b40360791535b42dbf1637f7693a3822.jpg naked olympics Visit the most prestigious all girl track and field university - the hottest students while training for the Olympics engage in the wettest sex ever. The La Perla Lingerie come off and these girls become wilder than they could ever be at home. They are so horny and the boys and soviet spies sneak in at all hours and the girls greet them with open cunt holes and hold penises in their fragile hands and mouths and help to insert them into each others virgin anuses and pussy tunnels - some times the whole huge beautiful super model all girl team lines up to each taste a new cock - sexual tortures for team secrets, trembling anal devirginizations - the girls use the cum for new powers and eat and strangle on each semen snow wad. The hottest babes you will ever see. A remarkable collectors edition. Go for the gold if not then go for the pussy! Lil women rule! 4 2 2009-08-21 Mature Adult Nopussygirlbeautifulhandshottesthornywomenwildanalmouthboystortureholeshugetrainingsecretmouthscuntlingeriepower http://www.iphods.com/movie/548/oil-overload-disc-1/ http://www.iphods.com/videos/56806bbef68a713106e16a1923190996.m4v http://www.iphods.com/clips/thumbs/56806bbef68a713106e16a1923190996.jpg Oil Overload (Disc 1) 2009 AVN Award Nominee for Best Director Non-Feature and Best Gonzo ReleaseSuperstars lubed and cum-hungry for an overload of throbbing cocks! These slippery sluts are sliding all over the place getting ready to be fried in a batch of cum! Without a need for KY they can slide into anyone of their waiting holes and hungry faces. These girls love a messy fuck!! 3.5 2 2009-08-01 Mature Adult Nogirlslovegirlslutscocksslutholesnomineeawardreleaseavn awardaward nomineedirectorfacesfeaturesuperstarbest director http://www.iphods.com/movie/548/oil-overload-disc-1/ http://www.iphods.com/videos/42a161de6e2153ad52c55f1fc3d68d27.m4v http://www.iphods.com/clips/thumbs/42a161de6e2153ad52c55f1fc3d68d27.jpg Oil Overload (Disc 1) 2009 AVN Award Nominee for Best Director Non-Feature and Best Gonzo ReleaseSuperstars lubed and cum-hungry for an overload of throbbing cocks! These slippery sluts are sliding all over the place getting ready to be fried in a batch of cum! Without a need for KY they can slide into anyone of their waiting holes and hungry faces. These girls love a messy fuck!! 2 2 2009-08-01 Mature Adult Nogirlslovegirlslutscocksslutholesnomineeawardreleaseavn awardaward nomineedirectorfacesfeaturesuperstarbest director http://www.iphods.com/movie/548/oil-overload-disc-1/ http://www.iphods.com/videos/b34d857dab563aa5867ed46fafe21f5c.m4v http://www.iphods.com/clips/thumbs/b34d857dab563aa5867ed46fafe21f5c.jpg Oil Overload (Disc 1) 2009 AVN Award Nominee for Best Director Non-Feature and Best Gonzo ReleaseSuperstars lubed and cum-hungry for an overload of throbbing cocks! These slippery sluts are sliding all over the place getting ready to be fried in a batch of cum! Without a need for KY they can slide into anyone of their waiting holes and hungry faces. These girls love a messy fuck!! 5 2 2009-08-01 Mature Adult Nogirlslovegirlslutscocksslutholesnomineeawardreleaseavn awardaward nomineedirectorfacesfeaturesuperstarbest director http://www.iphods.com/movie/504/olympic-fever/ http://www.iphods.com/videos/36e059bd0f765d7ccb4157e9ebb6f8de.m4v http://www.iphods.com/clips/thumbs/36e059bd0f765d7ccb4157e9ebb6f8de.jpg Olympic Fever The Olympics like you've never seen them before! Kristin Powers is a struggling swimmer hoping to make the U.S. Swim Team. She has a protein deficiency which prevents her from obtaining her dream of winning gold medals. Kristin sees a doctor who prescribes her a dosage of protein in the form of sperm. Kristin's swimming times improve rapidly. 2.5 2 2009-08-19 Mature Adult Noevenkrispower http://www.iphods.com/movie/505/carnal-olympics/ http://www.iphods.com/videos/ccb8d70d5eb7126f02e38bffb80f8729.m4v http://www.iphods.com/clips/thumbs/ccb8d70d5eb7126f02e38bffb80f8729.jpg Carnal Olympics The unrivaled indoor sports An X-rated magazine sponsored a contest to determine who's the sexiest girl in San Francisco. After an exhaustive and deep probing search, an ace reporter sniffs out two sizzling strumpets who'll do anything for the $20,000 prize money in a no-holds-barred Carnal Olympics. Event number one finds each team in a very hot girl-girl love making event where the judges give the gals a ten on technique alone. Event number two has each girl seducing an officer of the law in a hard-driving shoot out of a very personal nature. In the final and decisive event number three, a not-to-be-believed pool party turns into an orgy of truly Olympian proportions where everyone turns out to be a wild, wild winner. 4.5 2 2009-08-18 Mature Adult Nogirlpartywildevenanythingthreewinnerofficealonesexiestpoolorgyshoottruly http://www.iphods.com/movie/506/savage-security/ http://www.iphods.com/videos/f9747acf5a034b11d056120557cd589f.m4v http://www.iphods.com/clips/thumbs/f9747acf5a034b11d056120557cd589f.jpg Savage Security The savage security agency specialises in high profile protection. Their newest detail is the daughter of an eccentric billionaire. She has received seceral threats from an unknown assailant. It is Gina Lynn's job to keep her out of Harm's way! 5 2 2009-08-18 Mature Adult Nohighlynndaughter http://www.iphods.com/movie/507/fudgestick-volume-1/ http://www.iphods.com/videos/f45ff77b6b975b25031c14373adf751d.m4v http://www.iphods.com/clips/thumbs/f45ff77b6b975b25031c14373adf751d.jpg Fudgestick Volume 1 Laronn James is Fudgestick. Four horny big titty milfs go head to head with Laronn's meaty fudgestick in four scenes of nonstop rough interracial hardcore anal action. Laronn trains these MILFs to eat ass and take the fudgestick deep into all three holes. Moxxie is a tattooed MILF who has never been afraid of the dark. Kayla Quinn is a corn fed Southern white MILF that got booty like a black girl. Tabitha is an upper class MILF on vacation from New York to do some dirt that she doesn't want her husband to know about. Natasha Stone is a country ass milf coming to L.A. to get some rough ghetto lovin' with 10 inches of big black cock in nonstop rough action. All interracial, all amateur, all mature. 4.5 2 2009-08-15 Mature Adult Nohornydeepanalblackhardcoredoeswhitefourholesamateurdarkbootyhusbandmilfmilfsbig blackhardcore analinterracialinches http://www.iphods.com/movie/507/fudgestick-volume-1/ http://www.iphods.com/videos/d8f92de3653a3dd91d5bd66516910be9.m4v http://www.iphods.com/clips/thumbs/d8f92de3653a3dd91d5bd66516910be9.jpg Fudgestick Volume 1 Laronn James is Fudgestick. Four horny big titty milfs go head to head with Laronn's meaty fudgestick in four scenes of nonstop rough interracial hardcore anal action. Laronn trains these MILFs to eat ass and take the fudgestick deep into all three holes. Moxxie is a tattooed MILF who has never been afraid of the dark. Kayla Quinn is a corn fed Southern white MILF that got booty like a black girl. Tabitha is an upper class MILF on vacation from New York to do some dirt that she doesn't want her husband to know about. Natasha Stone is a country ass milf coming to L.A. to get some rough ghetto lovin' with 10 inches of big black cock in nonstop rough action. All interracial, all amateur, all mature. 5 2 2009-08-15 Mature Adult Nohornydeepanalblackhardcoredoeswhitefourholesamateurdarkbootyhusbandmilfmilfsbig blackhardcore analinterracialinches http://www.iphods.com/movie/510/how-to-please-a-she-male/ http://www.iphods.com/videos/45383d1d0c369fb70f5faeeb52ca9965.m4v http://www.iphods.com/clips/thumbs/45383d1d0c369fb70f5faeeb52ca9965.jpg How To Please A She-Male In an oral only movie devoted to she-males, Joey Silvera continues his obsession with She Males, extending the theme from lines like Rogue Adventures. With 4 well hung black she males (Nefertiti, Aimee Lee, Mistress Mina, and Hottie Cox), a pair of Brazilian She Males (Andreia and Adriana), and 3 white she males, there is a little something for every fan of this popular niche. 4 2 2009-08-15 Mature Adult Nomistressveryblackwhiteoralcontinuesmalepopularpair http://www.iphods.com/movie/510/how-to-please-a-she-male/ http://www.iphods.com/videos/703817235edc4300acfca714a8e82888.m4v http://www.iphods.com/clips/thumbs/703817235edc4300acfca714a8e82888.jpg How To Please A She-Male In an oral only movie devoted to she-males, Joey Silvera continues his obsession with She Males, extending the theme from lines like Rogue Adventures. With 4 well hung black she males (Nefertiti, Aimee Lee, Mistress Mina, and Hottie Cox), a pair of Brazilian She Males (Andreia and Adriana), and 3 white she males, there is a little something for every fan of this popular niche. 3.5 2 2009-08-15 Mature Adult Nomistressveryblackwhiteoralcontinuesmalepopularpair http://www.iphods.com/movie/511/international-she-males-2-ride-my-giant-cock/ http://www.iphods.com/videos/d2d687e9853d776878c5efa54a1c500b.m4v http://www.iphods.com/clips/thumbs/d2d687e9853d776878c5efa54a1c500b.jpg International She-Males #2 - Ride My Giant Cock WOW!! Five hours of nothing but transsexual action! Men getting fucked by chicks with dicks! She-males sticking their cocks inside of men...and women! All scenes vary in locale; out by the pool or in the bedroom, there's plenty of mutual cock sucking and a ton of anal! 4.5 2 2009-08-15 Mature Adult Nodicksuckingsexualwomensuckcockschicksbedroomchickdickspoolmale http://www.iphods.com/movie/512/big-beautiful/ http://www.iphods.com/videos/8c519e4369ddb2694eef1f7b90a7abd8.m4v http://www.iphods.com/clips/thumbs/8c519e4369ddb2694eef1f7b90a7abd8.jpg Big and Beautiful Big is beautiful! Big Tits, Big Cocks, Big Fun! Sexy tranny Three-Some's, Anal Sex, Blowjobs, Fucking, and most important the Money Shot! Horny she males that love to please, giving you intense pleasure either on their back or on their knees! Pull your hard cock out her phat ass, and bust a hot sticky load all over those big, beautiful breasts! Everyone knows big is the best!! 3 2 2009-08-14 Mature Adult Notitsbeautifulfuckinghornypleasureveryanalcocksthreeintenseblowjobsblowhard cockbreastskneesmaletranny http://www.iphods.com/movie/512/big-beautiful/ http://www.iphods.com/videos/3bebf9fc646a234a5065cb2c47bbe250.m4v http://www.iphods.com/clips/thumbs/3bebf9fc646a234a5065cb2c47bbe250.jpg Big and Beautiful Big is beautiful! Big Tits, Big Cocks, Big Fun! Sexy tranny Three-Some's, Anal Sex, Blowjobs, Fucking, and most important the Money Shot! Horny she males that love to please, giving you intense pleasure either on their back or on their knees! Pull your hard cock out her phat ass, and bust a hot sticky load all over those big, beautiful breasts! Everyone knows big is the best!! 5 2 2009-08-14 Mature Adult Notitsbeautifulfuckinghornypleasureveryanalcocksthreeintenseblowjobsblowhard cockbreastskneesmaletranny http://www.iphods.com/movie/513/monsters-of-she-male-cock-5/ http://www.iphods.com/videos/cf56f4a21fc4f1748fcce85acaab21ec.m4v http://www.iphods.com/clips/thumbs/cf56f4a21fc4f1748fcce85acaab21ec.jpg Monsters Of She Male Cock 5 Bigger is better, everybody knows that, but what happens when you have to deal with huge! As in Monsters? Well, if youre talking about SheMales, monsters are fucking swesome. Just check out these heavy hung chicks to see what being built really means. Imagine trying to stretch your mouth over one of these trobbing cocks. And then think how it wold feel up your ass! Ouch, that's big! 3 2 2009-08-14 Mature Adult Nofuckingbodyverycockschickshugeheavyshemalesmalemonster http://www.iphods.com/movie/519/san-francisco-lesbian-bondage-club-2/ http://www.iphods.com/videos/fc4daaee6fc0da13acdc16dae0d674c3.m4v http://www.iphods.com/clips/thumbs/fc4daaee6fc0da13acdc16dae0d674c3.jpg San Francisco Lesbian Bondage Club #2 Second in a series of Mistress Domination. Get ready for some tight nipple clipping and flogging ripe red butts are just some of the delightful punishments doled out by and to these bad babes. Toys and bondage center on women doing women who could ask for more? 4 2 2009-08-14 Mature Adult Nobondagepunishmentmistresswomenbutttoysseconddominationnipple http://www.iphods.com/movie/523/maid-for-punishment/ http://www.iphods.com/videos/d69e42f07e436c2ea3e53c2e56bfcaec.m4v http://www.iphods.com/clips/thumbs/d69e42f07e436c2ea3e53c2e56bfcaec.jpg Maid For Punishment After inheriting millions of dollars, Jacqueline and Michael decide to hire a maid staff to care for their estate. Instead of ordinary housekeepers, they choose to offer $100,000 for young ladies who will submit to Jacqueline's sadistic desires. Jessica and Jennifer accept the offer because they need the money; Jasmine accepts the job in order to fulfill her lifelong desire to be a pleasure slave. This movie chronicles the first four months at the Estate in which you will witness all three young ladies punished far beyond their limits. Spankings that lead to tears and a bruised bottom are a daily occurrence. You will even get a peak behind closed doors, where Jacqueline explores the more sexual side of domination. 4 2 2009-08-14 Mature Adult Nospankingyoungladiessexualevenfourlifebottomthreebehinddoordominationclose100% http://www.iphods.com/movie/527/flower-squirt-shower-6/ http://www.iphods.com/videos/2f7660b3db1021916b6413a0ca9cbb42.m4v http://www.iphods.com/clips/thumbs/2f7660b3db1021916b6413a0ca9cbb42.jpg Flower Squirt Shower 6 2009 AVN Award Nominee for Best Squirting ReleaseThe AVN award winning series, Flower's Squirt Shower, returns with the sixth volume, starring the goddess of gush, porn super star Flower Tucci. Volume's 2 and 3 have both been recipient's of AVN editor's choice reviews, and at this year's AVN awards the series won for Best Specialty Release - Squirting. Squirt Shower 6 is bigger, better, and wetter than ever. Featuring a squirt drenched bevy of beautiful starlets including Jada Fire, Sindee Jennings, Britney Stevens, Nicki Hunter, and Gianna. While there are many imitators, Elegant Angel is the company that porn fans can rely upon for squirting movies that celebrate female orgasms with camera work that doesn't stay wide when you want it to get up close and intimate. Director William H.'s camera lens is once again squirt soaked, as Flower Tucci subjects us to a relentless onslaught of female ejaculation. 3.5 2 2009-08-12 Mature Adult Nobeautifulevenorgasmorgasmsporndoesfemalecameranomineeawardintimateangelsquirtingreleaseavn awardsquirtaward nomineedirectorelegant angelgoddessflowermalemoviesviewclosefans http://www.iphods.com/movie/527/flower-squirt-shower-6/ http://www.iphods.com/videos/8b4931bb2e4ab27c158f53c0170ea07b.m4v http://www.iphods.com/clips/thumbs/8b4931bb2e4ab27c158f53c0170ea07b.jpg Flower Squirt Shower 6 2009 AVN Award Nominee for Best Squirting ReleaseThe AVN award winning series, Flower's Squirt Shower, returns with the sixth volume, starring the goddess of gush, porn super star Flower Tucci. Volume's 2 and 3 have both been recipient's of AVN editor's choice reviews, and at this year's AVN awards the series won for Best Specialty Release - Squirting. Squirt Shower 6 is bigger, better, and wetter than ever. Featuring a squirt drenched bevy of beautiful starlets including Jada Fire, Sindee Jennings, Britney Stevens, Nicki Hunter, and Gianna. While there are many imitators, Elegant Angel is the company that porn fans can rely upon for squirting movies that celebrate female orgasms with camera work that doesn't stay wide when you want it to get up close and intimate. Director William H.'s camera lens is once again squirt soaked, as Flower Tucci subjects us to a relentless onslaught of female ejaculation. 4.5 2 2009-08-12 Mature Adult Nobeautifulevenorgasmorgasmsporndoesfemalecameranomineeawardintimateangelsquirtingreleaseavn awardsquirtaward nomineedirectorelegant angelgoddessflowermalemoviesviewclosefans http://www.iphods.com/movie/527/flower-squirt-shower-6/ http://www.iphods.com/videos/e009f7bfedba2128d895248237dc7ccd.m4v http://www.iphods.com/clips/thumbs/e009f7bfedba2128d895248237dc7ccd.jpg Flower Squirt Shower 6 2009 AVN Award Nominee for Best Squirting ReleaseThe AVN award winning series, Flower's Squirt Shower, returns with the sixth volume, starring the goddess of gush, porn super star Flower Tucci. Volume's 2 and 3 have both been recipient's of AVN editor's choice reviews, and at this year's AVN awards the series won for Best Specialty Release - Squirting. Squirt Shower 6 is bigger, better, and wetter than ever. Featuring a squirt drenched bevy of beautiful starlets including Jada Fire, Sindee Jennings, Britney Stevens, Nicki Hunter, and Gianna. While there are many imitators, Elegant Angel is the company that porn fans can rely upon for squirting movies that celebrate female orgasms with camera work that doesn't stay wide when you want it to get up close and intimate. Director William H.'s camera lens is once again squirt soaked, as Flower Tucci subjects us to a relentless onslaught of female ejaculation. 3 2 2009-08-12 Mature Adult Nobeautifulevenorgasmorgasmsporndoesfemalecameranomineeawardintimateangelsquirtingreleaseavn awardsquirtaward nomineedirectorelegant angelgoddessflowermalemoviesviewclosefans http://www.iphods.com/movie/528/sport-babes/ http://www.iphods.com/videos/56fb4de752dcda5d3e0ff1952e401a37.m4v http://www.iphods.com/clips/thumbs/56fb4de752dcda5d3e0ff1952e401a37.jpg Sport Babes Let their silken love muscles grab it! Practice is over. The high impact fuck sluts of SPORT BABES #3 are ready to show the world what they're made of! When push comes to shove, these hall-of-fame whores can take on any prick, no matter what the size. Their bodies are tight, toned fucking machines. They tackle cock with the ferocity of a linebacker and catch facials like outfielders. Show them man-meat and their silken love muscles will grab it, swallow it, and milk the slab dry. Every time these seasoned sexual athletes take on a stiff opponent, the pairing is a total blow out. Everybody sweats, everybody comes, and everybody wins! 3 2 2009-08-12 Mature Adult Nolovetightfuckingbodysexualslutssluthighwhoresblowpair http://www.iphods.com/movie/529/squirting-201-vol-3/ http://www.iphods.com/videos/502e01b73ae410654eb6a4c693ad7a3c.m4v http://www.iphods.com/clips/thumbs/502e01b73ae410654eb6a4c693ad7a3c.jpg Squirting 201 Vol 3 Just when you thought it couldn't get more fun, more sexy, more outrageous, and more educational, Axel Braun once again tops himself and brings you another female ejaculation masterpiece! You will be shocked by seeing how much juice a woman can squirt. You will be amazed by learning how easy it is. And, ultimately, you'll become a believer! Get ready to get wet!!! 3 2 2009-08-11 Mature Adult Nomasterwomanfemalelearnsquirtmaleultimateshocked http://www.iphods.com/movie/531/little-midget-big-dicks-2/ http://www.iphods.com/videos/7d79a8de9dd8f41bcf9aac84264b5a45.m4v http://www.iphods.com/clips/thumbs/7d79a8de9dd8f41bcf9aac84264b5a45.jpg Little Midget Big Dicks #2 Can she take it? You bet she can! This horny little lady just loves great big cocks! Midget gets it on with some of the biggest dicks in town. You would think their half pint size just wouldn't fit so much dick, but you would be wrong they crave it and take every inch! 2 2 2009-08-08 Mature Adult Nodickcockslovesladydicksbiggest http://www.iphods.com/movie/532/my-aunt-likes-big-black-dicks/ http://www.iphods.com/videos/cda952a41a37e37cb3db13b474592aab.m4v http://www.iphods.com/clips/thumbs/cda952a41a37e37cb3db13b474592aab.jpg My Aunt Likes Big Black Dicks My aunt has discovered the joy of big black cocks! Now she just cannot get enough of those fine black brothers. Hotbox auntie takes on all the big, black studs! Long, Black, and juicy just drives these aunts wild! Cum and enjoy all the hot black on white action! 3.5 2 2009-08-08 Mature Adult Nocockwildstudscockswhitecoveredjuicybig black http://www.iphods.com/movie/534/bootylicious-lose-a-ho-gain-a-ho/ http://www.iphods.com/videos/ea9dd54b633f5defd03b069cbe5e5c0e.m4v http://www.iphods.com/clips/thumbs/ea9dd54b633f5defd03b069cbe5e5c0e.jpg Bootylicious: Lose A Ho', Gain A Ho' Stupid Ho's take big dick up their ass lockers, only to be thrown to the curb like the little trashy sluts that they truly are!! . DUMP DA BITCHES!! Like I always sez... LOSE A HO GAIN A HO, and it will all balance out in the end as long as your cock got stroked!!! 5 2 2009-08-08 Mature Adult Nodickslutsslutyour cockalwaysbitchestruly http://www.iphods.com/movie/535/milfs-gone-anal-vol-4/ http://www.iphods.com/videos/dfa29bd72d93b8f5640e51e453f65ce6.m4v http://www.iphods.com/clips/thumbs/dfa29bd72d93b8f5640e51e453f65ce6.jpg MILFS Gone Anal Vol. 4 Mama's taking it in the crack and she isn't ever coming back! Watch as some of our hottest MILFs turn into anal queens that just can't seem to get enough hard cock rammed in their ass! The Pink Visual crew is always obliged to help in a good ass fucking and we definitely like to take care of mama! 5 2 2009-08-08 Mature Adult Nofuckinghottestanalalwayshard cockmilfmilfsqueen http://www.iphods.com/movie/536/teenage-brotha-lovers-9/ http://www.iphods.com/videos/7d46652ec14a9ecccdfb879de61d08cd.m4v http://www.iphods.com/clips/thumbs/7d46652ec14a9ecccdfb879de61d08cd.jpg Teenage Brotha Lovers 9 Barely legal cuties, fresh out of high school, love that big black meat! They want to walk on the dark side and they get the toughest of meat... black meat! Full and ready to pound these little cuties until they explode all over there faces! It's all about the young chicks! 4.5 2 2009-08-08 Mature Adult Noloveschoolblackchickshighbaredarkchickfacesbig black http://www.iphods.com/movie/538/world-without-men/ http://www.iphods.com/videos/f66fe139667bd64fcfe21619773c6d5e.m4v http://www.iphods.com/clips/thumbs/f66fe139667bd64fcfe21619773c6d5e.jpg World Without Men In a film that could be subtitled World Without Knickers, some very attractive Brit girls do unspeakably dirty things to their own and their friend's pussies, often while tying each other up. Imaginatively photographed, the four scenes include all kinds of kinkiness! These bitches are hot! High quality lesbo fetish filth at its best! 3 2 2009-08-08 Mature Adult Nogirlsfilmfourfetishdirtyhighbitches http://www.iphods.com/movie/538/world-without-men/ http://www.iphods.com/videos/8747bae33b4b20cee0350cea8a7989d6.m4v http://www.iphods.com/clips/thumbs/8747bae33b4b20cee0350cea8a7989d6.jpg World Without Men In a film that could be subtitled World Without Knickers, some very attractive Brit girls do unspeakably dirty things to their own and their friend's pussies, often while tying each other up. Imaginatively photographed, the four scenes include all kinds of kinkiness! These bitches are hot! High quality lesbo fetish filth at its best! 3.5 2 2009-08-08 Mature Adult Nogirlsfilmfourfetishdirtyhighbitches http://www.iphods.com/movie/542/teenage-anal-eruptions/ http://www.iphods.com/videos/af2250fa8e3fc19ac4304f5df626072a.m4v http://www.iphods.com/clips/thumbs/af2250fa8e3fc19ac4304f5df626072a.jpg Teenage Anal Eruptions As if their fresh pussies weren't tight enough, these fresh young sluts spread open their virgin assholes for first time cum floods! Includes only the raunchiest taboo loops, including: Devil Cult: A black magic ritual turns a tiny virgin into an anal craving whore! Park Lovers: John Holmes takes a sweet young thing on a field trip to the zoo before jamming all 12" of cock up her rectum! Includes the absolute classic Tawny Pearl roller skating loop and more! 4.5 2 2009-08-08 Mature Adult Noloveyoungtightanalblackslutspussiesslutholesassholesincludescravingclassicfirst timeassholeloversloverspread http://www.iphods.com/movie/542/teenage-anal-eruptions/ http://www.iphods.com/videos/26bf1909734c7648986b18744a423779.m4v http://www.iphods.com/clips/thumbs/26bf1909734c7648986b18744a423779.jpg Teenage Anal Eruptions As if their fresh pussies weren't tight enough, these fresh young sluts spread open their virgin assholes for first time cum floods! Includes only the raunchiest taboo loops, including: Devil Cult: A black magic ritual turns a tiny virgin into an anal craving whore! Park Lovers: John Holmes takes a sweet young thing on a field trip to the zoo before jamming all 12" of cock up her rectum! Includes the absolute classic Tawny Pearl roller skating loop and more! 3 2 2009-08-08 Mature Adult Noloveyoungtightanalblackslutspussiesslutholesassholesincludescravingclassicfirst timeassholeloversloverspread http://www.iphods.com/movie/1408/briana-banks-more-lesbian-action/ http://www.iphods.com/videos/f171594c3aec6c58807b1d0fa3ebfb3a.m4v http://www.iphods.com/clips/thumbs/f171594c3aec6c58807b1d0fa3ebfb3a.jpg Briana Banks: More Lesbian Action Briana has a body anyone would die for...long, luscious legs, full round tits, and a tiny, tight ass that just begs for a reaming. Now you can see her beautiful body twist and bend in every position imaginable, in this collection of her award-winning sex scenes! Girl-on-girl, guy-on-girl, or just girl-on-herself, don't miss this breathtaking collection of the best scenes adult entertainment has to offer - especially with Briana Banks! 2.5 2 2005-04-22 Mature Adult Nogirltitsbeautifultightbodyverylegsawardespeciallyadultcollectiontight asssex sceneposition http://www.iphods.com/movie/545/insatiable/ http://www.iphods.com/videos/da3cf5ed636cf6e27bd2f8439a0524de.m4v http://www.iphods.com/clips/thumbs/da3cf5ed636cf6e27bd2f8439a0524de.jpg Insatiable AVN Top 500 Supermodel and heiress, Sandra Chase (Marilyn Chambers) quickly learns money can't buy happiness or satisfaction. While starring in her first movie, she finds herself caught in a wild web of sexual encounters with her co-stars. Insatiable also stars legendary John Holmes as Sandra's fantasy lover. Shot on location in rural America and cosmopolitan London, Insatiable will leave you hungry for more.. 3 2 2009-08-04 Mature Adult Nolovewildlearninsatiablefantasycaughtlover http://www.iphods.com/movie/547/all-up-in-her-grill-2-white-education/ http://www.iphods.com/videos/631db31baca630faf6ab58f4e16bd483.m4v http://www.iphods.com/clips/thumbs/631db31baca630faf6ab58f4e16bd483.jpg All Up In Her Grill 2 - White Education These white girls are getting their grills all messed up with cum all over them. They are taking black dicks like champs. One after another gets her pussy slammed and then they get cum all over their facesand in their mouths.Cum on their grillz! They want to wear their grillz while you fuck them! 3 2 2009-08-01 Mature Adult Nopussydickblackwhitemouthmouthsfacesdicks http://www.iphods.com/movie/548/oil-overload-disc-1/ http://www.iphods.com/videos/efd6a2fe8712833cb452d7530880dcaa.m4v http://www.iphods.com/clips/thumbs/efd6a2fe8712833cb452d7530880dcaa.jpg Oil Overload (Disc 1) 2009 AVN Award Nominee for Best Director Non-Feature and Best Gonzo ReleaseSuperstars lubed and cum-hungry for an overload of throbbing cocks! These slippery sluts are sliding all over the place getting ready to be fried in a batch of cum! Without a need for KY they can slide into anyone of their waiting holes and hungry faces. These girls love a messy fuck!! 2 2 2009-08-01 Mature Adult Nogirlslovegirlslutscocksslutholesnomineeawardreleaseavn awardaward nomineedirectorfacesfeaturesuperstarbest director http://www.iphods.com/movie/549/she-male-a-go-go/ http://www.iphods.com/videos/dbeb8e197488179a1cfff64c20d479f7.m4v http://www.iphods.com/clips/thumbs/dbeb8e197488179a1cfff64c20d479f7.jpg She-Male A Go-Go Well, you wouldn't expect it, but that bulge in her panties is not a swollen mound of vaginal pleasure. Instead, it's a cock. She's, I mean uh, well, I don't know exactly what I mean, but this is a hot orgy and you're invited. Are you ready to get your swerve on? 4 2 2009-08-01 Mature Adult Nocockpleasurepantiesorgy http://www.iphods.com/movie/550/love-honor-obey/ http://www.iphods.com/videos/af869e2eb7be94f8b578aa9cbe164768.m4v http://www.iphods.com/clips/thumbs/af869e2eb7be94f8b578aa9cbe164768.jpg Love, Honor and Obey Imagine if Lucy and Ricky were really in the scene and played hard. That is what you have with our Lydia and John. This scenario includes domestic discipline only, unobscured by kisses, caresses, sex or any other mushy stuff. On a severity scale, it's a nine and three quarters. It also has superb picture and sound quality, one of the prettiest couples we've ever featured with some of the livliest dialog ever. Fantastic spanking action abounds! 2.5 2 2009-08-01 Mature Adult Nospankingboundkissincludescouplesfeaturedcouplefeatureplayed http://www.iphods.com/movie/552/next-door-bi-encounter-vol-1/ http://www.iphods.com/videos/cdb43f638a537dcc94173bc097d80396.m4v http://www.iphods.com/clips/thumbs/cdb43f638a537dcc94173bc097d80396.jpg Next Door: Bi-Encounter Vol. 1 This is the one you have been waiting for! Next Door Studios releases its VERY FIRST Bi-Sexual DVD! Oh and did we mention that everybody's favorite Tyler Cummings is one of the main stars! This is your chance to see Tyler Cummings play with another man's cock, as well as has have his cock sucked and jerked by other hot guys, while engaged in some of the hottest Bi-Sexual action we have ever got on film! Six steamy scenes - sexy threesomes and even a foursome. 5 2 2009-08-01 Mature Adult Nohottestbodyfilmguyssuckplayfourthreedoorsteamyfavoriterelease http://www.iphods.com/movie/553/tippin-tha-scales-2/ http://www.iphods.com/videos/dafb1670d61828d571174097ce7dffca.m4v http://www.iphods.com/clips/thumbs/dafb1670d61828d571174097ce7dffca.jpg Tippin' Tha Scales 2 These BBW's are taking big cocks to their limits! Don't miss this slightly overweight beautiful ladies getting real acquainted with a big fat cock!!! Pull up a seat and watch these "Big Boneded" bootylicious babes back that thang up. These hoochies got hips, dips and dick suckin lips...and they are ready to put it all out there for you! If you like big girls who know how to work it, then this is one movie you dont wanna miss! 3 2 2009-08-01 Mature Adult Noladiescocksbootylips http://www.iphods.com/movie/553/tippin-tha-scales-2/ http://www.iphods.com/videos/bb9d8b555e02f51d37ee54562a1de810.m4v http://www.iphods.com/clips/thumbs/bb9d8b555e02f51d37ee54562a1de810.jpg Tippin' Tha Scales 2 These BBW's are taking big cocks to their limits! Don't miss this slightly overweight beautiful ladies getting real acquainted with a big fat cock!!! Pull up a seat and watch these "Big Boneded" bootylicious babes back that thang up. These hoochies got hips, dips and dick suckin lips...and they are ready to put it all out there for you! If you like big girls who know how to work it, then this is one movie you dont wanna miss! 2 2 2009-08-01 Mature Adult Noladiescocksbootylips http://www.iphods.com/movie/553/tippin-tha-scales-2/ http://www.iphods.com/videos/7833650c3adfd12b2a73c87a2b19ce17.m4v http://www.iphods.com/clips/thumbs/7833650c3adfd12b2a73c87a2b19ce17.jpg Tippin' Tha Scales 2 These BBW's are taking big cocks to their limits! Don't miss this slightly overweight beautiful ladies getting real acquainted with a big fat cock!!! Pull up a seat and watch these "Big Boneded" bootylicious babes back that thang up. These hoochies got hips, dips and dick suckin lips...and they are ready to put it all out there for you! If you like big girls who know how to work it, then this is one movie you dont wanna miss! 3.5 2 2009-08-01 Mature Adult Noladiescocksbootylips http://www.iphods.com/movie/557/more-cushion-for-the-pushin-2/ http://www.iphods.com/videos/dc45587b549811eb4b7af5051250f2c4.m4v http://www.iphods.com/clips/thumbs/dc45587b549811eb4b7af5051250f2c4.jpg More Cushion For The Pushin' #2 Cassandra loves sucking dick and smothering guys with her ample ass! We oiled up naughty new comer Noels voluptuous body before we let Nick go to town on that ass! Ally Foster is a pretty young thing from Indiana with a great set of 38D yabos! 19 year-old blonde hottie Oklahoma wants you to eat her pussy and then fuck her hard! Victoria Vonn is a passionate tramp from Florida who is always thirsty for hard cock. If all natural curvaceous sluts make you horny , they you'll love more cushion for the pushin' #2. 5 2 2009-07-29 Mature Adult Nocockpussyyoungdicksuckingbodyhornyguyssuckslutsprettyblondeslutlovesnaturalnaughtyalwayshard cocksmotheringpassionatevoluptuous http://www.iphods.com/movie/560/its-a-daddy-thing-4/ http://www.iphods.com/videos/a531ba2938f2f271ef9b71e7651b186f.m4v http://www.iphods.com/clips/thumbs/a531ba2938f2f271ef9b71e7651b186f.jpg It's A Daddy Thing! 4 2009 AVN Award Winner for Best Young Girl Series.Patrick Collins returns with another collection of prissy, cock teasing teens in Elegant Angel's It's a Daddy Thing 4. Alexis Love, Evie Delatosso, Nika, Naomi Cruise, and Nikki Flame star as filthy young flirtatious sluts, provocatively seducing older guys. The movie is a sexually sophisticated depiction of fantasy role-playing at its best. Elegant Angel is the porn company that customers can rely upon for a more creative brand of eroticism. 5 2 2009-07-24 Mature Adult Nococklovegirlguysplayslutspornsluteroticawardwinnerangelolderteasingfantasyavn awardcollectionelegant angelcollinssexuallyaward winnerfilthy http://www.iphods.com/movie/563/bound-gagged-damsels-2/ http://www.iphods.com/videos/3bcf54679f38c5c4d44c2a2b5a5f6aef.m4v http://www.iphods.com/clips/thumbs/3bcf54679f38c5c4d44c2a2b5a5f6aef.jpg Bound and Gagged Damsels 2 Eight bondage tales with serious damsel action! Abduction! Ransom! Full nudity and fondling! Kidnappings with onscreen grabbing, tying, gagging and molesting -- this is a bondage film not to be missed if you are a diehard fan of damsel-in-distress action! Eight scenes, eleven hot models, 75 minutes! 5 2 2009-07-24 Mature Adult Nobondagefilm http://www.iphods.com/movie/565/bi-bi-love-4/ http://www.iphods.com/videos/d419e67bed7ab273f6b652b93e3a9afa.m4v http://www.iphods.com/clips/thumbs/d419e67bed7ab273f6b652b93e3a9afa.jpg Bi-Bi Love 4 These bisexual lovers go both ways! Whether it's a cock, pussy, asshole, or mouth, they just do it all! And who could blame them switching things up a bit? I mean, if you were surrounded with rock hard cock and dripping wet pussy, wouldn't you want a taste of both? 4.5 2 2009-07-24 Mature Adult Nolovedrippingbisexualrock hardhard cockloverslover http://www.iphods.com/movie/567/evie-young-tight-latinas/ http://www.iphods.com/videos/3d03e12481099165ec74e34fb99b4429.m4v http://www.iphods.com/clips/thumbs/3d03e12481099165ec74e34fb99b4429.jpg Evie - Young Tight Latinas Think it gets hot where you are, well come down below the border with us and try some of the spicy dippin' we've got for you here! Warm, soft senoritas are just waiting to show you how ready they are to suck your big dick just to get themselves hot enough to sizzle. Then get ready for the searing; ball draining screwin' that only these sex starved Latin Honeys can give you. If you like it hot, really hot... you're on your way to a Latin sex fiesta with non-stop chiquita's doing their thing, and yours too! 2.5 2 2009-07-23 Mature Adult Nosuckball http://www.iphods.com/movie/560/its-a-daddy-thing-4/ http://www.iphods.com/videos/8fb0c78e95ca9548e7db3cf42cf6fcfb.m4v http://www.iphods.com/clips/thumbs/8fb0c78e95ca9548e7db3cf42cf6fcfb.jpg It's A Daddy Thing! 4 2009 AVN Award Winner for Best Young Girl Series.Patrick Collins returns with another collection of prissy, cock teasing teens in Elegant Angel's It's a Daddy Thing 4. Alexis Love, Evie Delatosso, Nika, Naomi Cruise, and Nikki Flame star as filthy young flirtatious sluts, provocatively seducing older guys. The movie is a sexually sophisticated depiction of fantasy role-playing at its best. Elegant Angel is the porn company that customers can rely upon for a more creative brand of eroticism. 4 2 2009-07-24 Mature Adult Nococklovegirlguysplayslutspornsluteroticawardwinnerangelolderteasingfantasyavn awardcollectionelegant angelcollinssexuallyaward winnerfilthy http://www.iphods.com/movie/560/its-a-daddy-thing-4/ http://www.iphods.com/videos/d350fdb7932f1371acb99089ab7e1beb.m4v http://www.iphods.com/clips/thumbs/d350fdb7932f1371acb99089ab7e1beb.jpg It's A Daddy Thing! 4 2009 AVN Award Winner for Best Young Girl Series.Patrick Collins returns with another collection of prissy, cock teasing teens in Elegant Angel's It's a Daddy Thing 4. Alexis Love, Evie Delatosso, Nika, Naomi Cruise, and Nikki Flame star as filthy young flirtatious sluts, provocatively seducing older guys. The movie is a sexually sophisticated depiction of fantasy role-playing at its best. Elegant Angel is the porn company that customers can rely upon for a more creative brand of eroticism. 3.5 2 2009-07-24 Mature Adult Nococklovegirlguysplayslutspornsluteroticawardwinnerangelolderteasingfantasyavn awardcollectionelegant angelcollinssexuallyaward winnerfilthy http://www.iphods.com/movie/569/faye-reagan-redhead-week/ http://www.iphods.com/videos/953b091527c3532fab04b220d75164f2.m4v http://www.iphods.com/clips/thumbs/953b091527c3532fab04b220d75164f2.jpg Faye Reagan - RedHead Week Young, dumb and covered in cum... That's the way we love 'em! Six fresh-faced teen whores are getting fucked, stuffed and gagged with cock right in front of our cameras for the very first time. Our horny guys are let loose on these cute little fuck sluts, and they drill their tight pink holes with rock hard dicks until they scream their lungs out! Then our teen tramps suck massive fuck tools until they get completely plastered in load after load of steaming hot cum, which they lick up like ice cream. You'll swear you're in teen twat heaven. 4.5 2 2009-07-22 Mature Adult Noloveyoungtightdickhornyguysveryslutsgaggedholeswhorescutecoveredmassivecreamrock hardfirst timedickscompletelycompletestuffed http://www.iphods.com/movie/571/spunkd-the-movie/ http://www.iphods.com/videos/a15d68f5f6b07d2e9b09a033095903b0.m4v http://www.iphods.com/clips/thumbs/a15d68f5f6b07d2e9b09a033095903b0.jpg Spunk'd The Movie One of the best porn parodies in recent memory, Nick Manning heads up this all-star porn cast parodying some of the biggest stars in Hollywood. Nick Manning plays Gashton Cootcher who "spunks" his celebrity friends by setting them up in outrageous sexual situations and then reveals the prank each time by "dropping loads" himself on the celebrity's face. Penny Flame convincingly plays "Lindsey Blowhan" getting a strip search and then a "full cavity search" from Wilmer Balled-Yer-Mama while a security guard provides some comedic commentary. One of the funnier parts of this scene comes from the dog. Next, Lexi Belle and Aurora Snow play "Cornhole Richie" and "Hairless Hilton" two rich primadonnas who get stuck staying with a horny, hillbilly family for their reality show.They proceed to get "home schooled" sex education classes from the back woods family. Kaiya Lynn, Katie Morgan and Steven St. Croix parody Grey's Anatomy. A "guest director" makes some script changes that have "Kathryn Hymen" and "Sand 3.5 2 2009-07-18 Mature Adult Nopussysexyhandsschooldickhornysexualevenplayporndoesboyfriendfriendsholesashleyangellearnhairsquirtinglipsblowsquirtdirectorasseslynnflowerjeremylessonendsballplayed,sisters,decide,table,truly,biggest,hollywood http://www.iphods.com/movie/576/mean-bitches-erotic-femdom-2/ http://www.iphods.com/videos/f220586e7eed3cec767e1c961082726f.m4v http://www.iphods.com/clips/thumbs/f220586e7eed3cec767e1c961082726f.jpg Mean Bitches - Erotic FemDom 2 Do you belong at the feet of a beautiful woman? Are you ready to be hypnotized, enslaved, and used by a goddess? Are you helpless around the young cheerleaders who used to laugh at you when you were in college? Are you ready for some big-ass facesitting and smothering? If so, this is the dvd for you! This DVD features gorgeous women and their slaved with lots of ass worship, facesitting, foot worship and erotic female domination! Don't miss scene two with Nautica Thorn and Tommy Gunn playing superhero! It's hilarious, and you know with two of the best performers in adult, it's totally hot! 5 2 2009-07-16 Mature Adult Noyoungbeautifulslavewomenwomanplayfeetfootfemaleeroticusedfacesittingdominationadultfacessmotheringgoddessass worshipfeaturemalehelpless http://www.iphods.com/movie/576/mean-bitches-erotic-femdom-2/ http://www.iphods.com/videos/2886f74456fda7ffa768ec412dc0746f.m4v http://www.iphods.com/clips/thumbs/2886f74456fda7ffa768ec412dc0746f.jpg Mean Bitches - Erotic FemDom 2 Do you belong at the feet of a beautiful woman? Are you ready to be hypnotized, enslaved, and used by a goddess? Are you helpless around the young cheerleaders who used to laugh at you when you were in college? Are you ready for some big-ass facesitting and smothering? If so, this is the dvd for you! This DVD features gorgeous women and their slaved with lots of ass worship, facesitting, foot worship and erotic female domination! Don't miss scene two with Nautica Thorn and Tommy Gunn playing superhero! It's hilarious, and you know with two of the best performers in adult, it's totally hot! 2.5 2 2009-07-16 Mature Adult Noyoungbeautifulslavewomenwomanplayfeetfootfemaleeroticusedfacesittingdominationadultfacessmotheringgoddessass worshipfeaturemalehelpless http://www.iphods.com/movie/578/moms-a-cheater-volume-3/ http://www.iphods.com/videos/3e8d0fd8db3f83cd5f8addfd74892337.m4v http://www.iphods.com/clips/thumbs/3e8d0fd8db3f83cd5f8addfd74892337.jpg Moms A Cheater Volume 3 You thought your best friend's mom was a goody-two-shoes? Well, THINK AGAIN! Watch hot, sexy MILFs run around like wild whores, fucking like wild animals and cheating on their loser husbands. Enjoy! 4.5 2 2009-07-16 Mature Adult Nosexyfuckingwildwhoreshusbandmilfmilfsshoes http://www.iphods.com/movie/578/moms-a-cheater-volume-3/ http://www.iphods.com/videos/c9557bff4b64f43f90c3753e9cfad361.m4v http://www.iphods.com/clips/thumbs/c9557bff4b64f43f90c3753e9cfad361.jpg Moms A Cheater Volume 3 You thought your best friend's mom was a goody-two-shoes? Well, THINK AGAIN! Watch hot, sexy MILFs run around like wild whores, fucking like wild animals and cheating on their loser husbands. Enjoy! 5 2 2009-07-16 Mature Adult Nosexyfuckingwildwhoreshusbandmilfmilfsshoes http://www.iphods.com/movie/581/shock-pussy-volume-two/ http://www.iphods.com/videos/081159426bc8959eb640046b056a6bec.m4v http://www.iphods.com/clips/thumbs/081159426bc8959eb640046b056a6bec.jpg Shock Pussy Volume Two Just when you think you've seen it all, get electrified with the talents of these horny sluts as they take hardcore girl-girl to the extreme. Shock Pussy is ocular orgasm induced by weird sex toys, latex fetish gear, wired foreplay, fuck machines and lots of power tools. You've never seen pussy so eager to be fucked like this before. ~Sky Blue 4 2 2009-07-16 Mature Adult Nopussyhornyplayslutshardcoreorgasmfetishtoyseagerlatexextremepowerblue http://www.iphods.com/movie/581/shock-pussy-volume-two/ http://www.iphods.com/videos/e464e0760a75fbb4967c793d654b843e.m4v http://www.iphods.com/clips/thumbs/e464e0760a75fbb4967c793d654b843e.jpg Shock Pussy Volume Two Just when you think you've seen it all, get electrified with the talents of these horny sluts as they take hardcore girl-girl to the extreme. Shock Pussy is ocular orgasm induced by weird sex toys, latex fetish gear, wired foreplay, fuck machines and lots of power tools. You've never seen pussy so eager to be fucked like this before. ~Sky Blue 4.5 2 2009-07-16 Mature Adult Nopussyhornyplayslutshardcoreorgasmfetishtoyseagerlatexextremepowerblue http://www.iphods.com/movie/581/shock-pussy-volume-two/ http://www.iphods.com/videos/61df8a12bebfb4996ae3c55806048805.m4v http://www.iphods.com/clips/thumbs/61df8a12bebfb4996ae3c55806048805.jpg Shock Pussy Volume Two Just when you think you've seen it all, get electrified with the talents of these horny sluts as they take hardcore girl-girl to the extreme. Shock Pussy is ocular orgasm induced by weird sex toys, latex fetish gear, wired foreplay, fuck machines and lots of power tools. You've never seen pussy so eager to be fucked like this before. ~Sky Blue 5 2 2009-07-16 Mature Adult Nopussyhornyplayslutshardcoreorgasmfetishtoyseagerlatexextremepowerblue http://www.iphods.com/movie/581/shock-pussy-volume-two/ http://www.iphods.com/videos/95bce9e1d6dd4f7ec859d2ed0f92387e.m4v http://www.iphods.com/clips/thumbs/95bce9e1d6dd4f7ec859d2ed0f92387e.jpg Shock Pussy Volume Two Just when you think you've seen it all, get electrified with the talents of these horny sluts as they take hardcore girl-girl to the extreme. Shock Pussy is ocular orgasm induced by weird sex toys, latex fetish gear, wired foreplay, fuck machines and lots of power tools. You've never seen pussy so eager to be fucked like this before. ~Sky Blue 3.5 2 2009-07-16 Mature Adult Nopussyhornyplayslutshardcoreorgasmfetishtoyseagerlatexextremepowerblue http://www.iphods.com/movie/586/squirt-gangbang/ http://www.iphods.com/videos/b845edfb20aed3cf884acee2b9d2cdaa.m4v http://www.iphods.com/clips/thumbs/b845edfb20aed3cf884acee2b9d2cdaa.jpg Squirt Gangbang 2008 AVN Award Nominee for Best Squirting Release. Elegant Angel proudly presents the eagerly anticipated SQUIRT GANGBANG, starring Sasha Grey and Chelsie Rae. This movie is a torrential downpour of epic proportions. Imagine all of your favorite squirting vixens together in one room, directing all of their focus on drenching one very lucky (and very wet) porn princess. If you think you've seen squirting before in Squirtwoman, Swallow My Squirt, and Squirt In My Gape, then think again. SQUIRT GANGBANG is arguably greatest squirt series of them all and a non ride of orgasmic eruptions. DO NOT MISS! 2 2 2009-07-11 Mature Adult Nowomanorgasmpornridenomineeangeleagerfavoritesquirtingreleaseavn awardsquirtaward nomineeelegant angelbanglucky http://www.iphods.com/movie/595/bi-bareback-orgy/ http://www.iphods.com/videos/c4a2ca3c5321dce093e731d199ebaf91.m4v http://www.iphods.com/clips/thumbs/c4a2ca3c5321dce093e731d199ebaf91.jpg Bi Bareback Orgy That slut Jessica Drew wants to spice things between her and boyfriend Farius Caine. She invites in young studs Rusty Stevenson, Kevin Rocha, Paul Black, and Johnny Walker. The pussy eating, cock sucking and raw cunt and ass fucking take over until everyone's desires are fulfilled. 3 2 2009-07-10 Mature Adult Nocockpussyyoungfuckingsuckingstudsveryblackslutboyfriendfilledcunt http://www.iphods.com/movie/596/gina-lynns-dds-derrieres-3/ http://www.iphods.com/videos/df162570c99b8f557a52e441e7bf20b5.m4v http://www.iphods.com/clips/thumbs/df162570c99b8f557a52e441e7bf20b5.jpg Gina Lynn's DDs and Derrieres 3 Gina Lynn shows Mikey how sexy she can be! Puma Swede pushes Travis to his limits! Nikki Benz gets a load all over her big tits! This is Krystal Steals FIRST SCENE in two years and Travis fucks the hell out of her! You can't miss the 3 hot blondes eating each other's pussy!!! 2.5 2 2009-07-09 Mature Adult Nosexytitsblondehellfuckslynn http://www.iphods.com/movie/597/the-greatest-squirts-ever-2/ http://www.iphods.com/videos/c03490506a9352c5e1b7e4bad586b7eb.m4v http://www.iphods.com/clips/thumbs/c03490506a9352c5e1b7e4bad586b7eb.jpg The Greatest Squirts Ever! 2 Ever since Cytherea's first orgasmic gushes of squirt on an Elegant Angel porn set the landscape of gonzo pornography was forever changed. While female orgasms have always been a pre-occupation of Elegant Angel owner, Patrick Collins, the awe struck delight he took in personally making Cytherea erupt girl goo all over his office furniture, the walls, the ceiling, and Elegant Angel videographer/director William H., redefined his entire company. What had previously been a remote niche' specialty was set for a contemporary overhaul as Patrick Collins infused the genre with the wonderment and marvel of a real porn fan that Cytherea's talents deserved. The result was "Cytherea Iz Squirtwoman," a rollercoaster, blockbuster success, and the beginnings of Elegant Angel's resurgence in the industry. Since the stratospheric success of the Squirtwoman series, Patrick Collins and William H. have thoroughly enjoyed themselves indulging in the squirting talents of a long list of gushing superstars: from "Squirtwoman," Cyth 3.5 2 2009-07-09 Mature Adult Nowomanvideoveryorgasmorgasmspornfemalealwaysangelusedofficesquirtingsquirtdirectorelegant angellynnfeaturedflowercollinsfeaturesuperstarmaletable http://www.iphods.com/movie/598/sindee-jones-is-supersquirt/ http://www.iphods.com/videos/6ad60277d5e52366e64df1103eee08e3.m4v http://www.iphods.com/clips/thumbs/6ad60277d5e52366e64df1103eee08e3.jpg Sindee Jones is Supersquirt 2009 AVN Award Nominee for Best Squirting ReleaseGet your slickers ready! Elegant Angel's hit series, Supersquirt, returns starring the insatiable Sindee Jennings, the newly crowned princess of orgasmic squirt eruptions.William H. has directed five scenes of face splashing, tit drenching, ass dousing, soaking wet debauchery. The torrential downpour of orgasmic fluids also stars Jenna Presley, Annie Cruz, Britney Stevenes, Chelsie Rae, and Flower Tucci. 3.5 2 2009-07-08 Mature Adult Nonomineeawardangelsquirtinginsatiablesquirtaward nomineeelegant angelflower http://www.iphods.com/movie/601/ticklish-surprise/ http://www.iphods.com/videos/ac28cb34d4e37a0441d2731625f61666.m4v http://www.iphods.com/clips/thumbs/ac28cb34d4e37a0441d2731625f61666.jpg Ticklish Surprise 5 VERY ticklish girls....see it all in this video! Barefeet, nylons, stocks, arm cuffs, restrained on the sofa, hogtied, gagged, a foot massage that turns into wild tickling AND the Tickle Master at his best!!! You will see tickle torture of all kinds ~ foot tickling, armpits, knees, even a feather in the face and on the neck!! And we are so proud to introduce Avery. You won't want to miss her response and her incredible laughter!! 3.5 2 2009-07-03 Mature Adult Notiedmasterwildveryevenfeetfoottorturegaggedticklebarekneesticklishnylonincredibletickling http://www.iphods.com/movie/606/transexual-prostitutes-54/ http://www.iphods.com/videos/84935b588c93d0193c6b3d42e6fc955f.m4v http://www.iphods.com/clips/thumbs/84935b588c93d0193c6b3d42e6fc955f.jpg Transexual Prostitutes 54 Do you LOVE your Trannys so much that you can taste it? Well then, this Special Ass Eating Edition is just for you! Every one of these luscious Trannys gets their turd-clipper munched, probed and licked clean by horny, lust crazed ass-raptors. What could be nastier than slipping your tongue deep inside some warm, stinking Tranny anus? NOTHING!! 5 2 2009-07-02 Mature Adult Nohornytonguecleantrannydeep inside http://www.iphods.com/movie/627/maid-for-bondage/ http://www.iphods.com/videos/cc467cdcc66529115190f4e3f8b3c193.m4v http://www.iphods.com/clips/thumbs/cc467cdcc66529115190f4e3f8b3c193.jpg maid for bondage These sexy Maids need some severe training and that's just what they get from the incredible Mistress Chanta Rose! First, Maxine X gives sexy, sultry, Jewell Marceau some lessons in how to be a good maid for Mistress Chanta. Jewell ends up in strict bondage and the crop is used to control her recalcitrant behavior. After forcing her to orgasm, Jewell turns the tables on Maxine X and has her way with her bound to a bed frame and fucked senseless with her powerful fucking machine. Then, its back to see Mistress as Maxine is strung up from the rafters and all her holes are violating in a severe femdom scene you will never forget! Hard-core Bondage, BDSM Forced Orgasms, Humiliation Fucking Machine in Bondage Gags, Squirting, DP, Ana,l Suspension Bondage, Oral Sex Whips, Deep Throat Training, Triple Penetration in Bondage, Foot Worship, Strap-on Sex and much more! 4 2 2009-06-23 Mature Adult Nosexybondageboundfuckingmistressforcedorgasmorgasmsholestrainingusedwhiporalsquirtingsquirtjewelllessonendsgagspowermarceautableincredibleseverejewell marceaupenetrationhumiliation http://www.iphods.com/movie/687/masturbation-celebration/ http://www.iphods.com/videos/918586e037d47aedc839a9f5a628ece2.m4v http://www.iphods.com/clips/thumbs/918586e037d47aedc839a9f5a628ece2.jpg Masturbation Celebration Sweetmeats proudly presents, the all girl gathering where no one leaves until every pussy is soaking and satisfied!! More real orgasms and totally drenched pussies make Masturbation Celebration another one of our finest films. Be sure not to miss this, sex fiends! 2 2 2009-05-22 Mature Adult Nogirlorgasmorgasmspussiesmasturbationfilmsendsleaves http://www.iphods.com/movie/840/auf-die-knie-mit-den-spermasauen/ http://www.iphods.com/videos/10a97210ff582c24d1885acacddb8d37.m4v http://www.iphods.com/clips/thumbs/10a97210ff582c24d1885acacddb8d37.jpg Auf Die Knie Mit Den Spermasauen! These women are extremely sexy and ready to suck cock. This guy lets you see it from his point of view. These ladies are sucking him, until he explodes onto their faces. Then they swallow each and every drop. Cum watch what he has created for you...you can see it, how he sees it! 2 2 2009-01-18 Mature Adult Noladiessuckingwomensuck cockfacesextremeview http://www.iphods.com/movie/884/this-is-extreme/ http://www.iphods.com/videos/be177506ab27b9f461132d3dc9e43463.m4v http://www.iphods.com/clips/thumbs/be177506ab27b9f461132d3dc9e43463.jpg This Is Extreme Four scenes of some strange / bizarre acts. Scene One features a brunette in a wheelchair who does a double blowjob, one to a regular guy and another to a midget. Scene 2 has a sexy blonde, naked in a pool of meat and meat blood... Scene 3 an all out gang bang and our last scene has a foxy, blonde teen getting a good face fuck, gag and slapped with cock in her mouth. 4 2 2009-12-07 Mature Adult Nosexydoubleblondedoesmouthfourbrunettehairblowpoolnakedfeaturebizarrebangregular http://www.iphods.com/movie/1096/tippin-tha-scales/ http://www.iphods.com/videos/abdc0f09fb7b0fb405fddfa3ae576c76.m4v http://www.iphods.com/clips/thumbs/abdc0f09fb7b0fb405fddfa3ae576c76.jpg Tippin' Tha Scales Big Beautiful Women Certified! The ass and titties are not just big in this bra busting flick, they're enormous! Variety is the spice of life and we got it, white, black and Spanish fly honeys own this zone! These hotties are gorgeous and can rock a cock like no other chick can! 3 2 2009-07-10 Mature Adult Nocockbeautifulwomenwhitelifehottieschick http://www.iphods.com/movie/1405/little-girls-blue-uncut-1-more-classic-fun/ http://www.iphods.com/videos/55a4392d1f8cb51ec54d4476cd317b55.m4v http://www.iphods.com/clips/thumbs/55a4392d1f8cb51ec54d4476cd317b55.jpg Little Girls Blue Uncut 1: More classic fun 2006 AVN Award Nominee for {Best Classic DVD} XRCO Hall of Fame Movie! It's a fresh take on the boarding school theme. Don't worry, the girls still engage in lots of sexual shenanigans with each other, their college faculty and staff, but this movie has something the others sadly lack: an IQ well above room temperature and a wit sharper than the high heels its stars are constantly slipping out of! Made in 1977, this title is a true classic and many of its stars will now seem like fresh new faces. This film is fun to watch as a time capsule of sorts containing 70's utterly care-free sex and totally natural bodies! 2.5 2 2005-05-23 Mature Adult Noschoolsexualfilmnomineenaturalawardclassicavn awardaward nomineefacesheelsfree http://www.iphods.com/movie/1405/little-girls-blue-uncut-1-more-classic-fun/ http://www.iphods.com/videos/c5fb234016864d72e30333dc41f98993.m4v http://www.iphods.com/clips/thumbs/c5fb234016864d72e30333dc41f98993.jpg Little Girls Blue Uncut 1: More classic fun 2006 AVN Award Nominee for {Best Classic DVD} XRCO Hall of Fame Movie! It's a fresh take on the boarding school theme. Don't worry, the girls still engage in lots of sexual shenanigans with each other, their college faculty and staff, but this movie has something the others sadly lack: an IQ well above room temperature and a wit sharper than the high heels its stars are constantly slipping out of! Made in 1977, this title is a true classic and many of its stars will now seem like fresh new faces. This film is fun to watch as a time capsule of sorts containing 70's utterly care-free sex and totally natural bodies! 2.5 2 2005-05-23 Mature Adult Noschoolsexualfilmnomineenaturalawardclassicavn awardaward nomineefacesheelsfree http://www.iphods.com/movie/2/crash-pad-series-episode-17-dylans-solo/ http://www.iphods.com/videos/3c9de5f85f5a3d14f7d0c94443c04ddc.m4v http://www.iphods.com/clips/thumbs/3c9de5f85f5a3d14f7d0c94443c04ddc.jpg Crash Pad Series - Episode 17: Dylan's Solo Voyeur Dylan cums out of the closet and revels in the spoils of her guilty pleasure. "I imagine that closet got pretty hot watching those two go at it. I knew Dylan was naughty, but watching her writhe in the sex soaked sheets of Dallas and Shawn, that's straight up nasty. I suppose that's why I adore her so much. Pervy girls are my favorite." -Key Master 2.5 1 2009-07-08 Mature Adult Nogirlsnastypleasuremasterprettynaughtyfavoritecumsclose http://www.iphods.com/movie/2/crash-pad-series-episode-17-dylans-solo/ http://www.iphods.com/videos/fccac19c8583e2a5c0bf6b7ce724eab8.m4v http://www.iphods.com/clips/thumbs/fccac19c8583e2a5c0bf6b7ce724eab8.jpg Crash Pad Series - Episode 17: Dylan's Solo Voyeur Dylan cums out of the closet and revels in the spoils of her guilty pleasure. "I imagine that closet got pretty hot watching those two go at it. I knew Dylan was naughty, but watching her writhe in the sex soaked sheets of Dallas and Shawn, that's straight up nasty. I suppose that's why I adore her so much. Pervy girls are my favorite." -Key Master 2 1 2009-07-08 Mature Adult Nogirlsnastypleasuremasterprettynaughtyfavoritecumsclose http://www.iphods.com/movie/2/crash-pad-series-episode-17-dylans-solo/ http://www.iphods.com/videos/a21723ea23c276fa96d989ba523bb690.m4v http://www.iphods.com/clips/thumbs/a21723ea23c276fa96d989ba523bb690.jpg Crash Pad Series - Episode 17: Dylan's Solo Voyeur Dylan cums out of the closet and revels in the spoils of her guilty pleasure. "I imagine that closet got pretty hot watching those two go at it. I knew Dylan was naughty, but watching her writhe in the sex soaked sheets of Dallas and Shawn, that's straight up nasty. I suppose that's why I adore her so much. Pervy girls are my favorite." -Key Master 2 1 2009-07-08 Mature Adult Nogirlsnastypleasuremasterprettynaughtyfavoritecumsclose http://www.iphods.com/movie/3/traditional-college-punishment-2/ http://www.iphods.com/videos/77173a43e5196aa61e453dfae68b4ea7.m4v http://www.iphods.com/clips/thumbs/77173a43e5196aa61e453dfae68b4ea7.jpg Traditional College Punishment #2 Simpkins is quite the disciplinarian as head schoolmaster. He is not one to relent at the first mournful cries of anguish. And these girls certainly are crying out in pain! As the limber cane rises and falls, their bottoms receive red welts. Are they repenting? Only time will tell. Simpkins will always have his cane at hand giving the girls swift cracks to the ass. 2 1 2009-07-08 Mature Adult Nogirlpainschoolmasterbottomalways http://www.iphods.com/movie/3/traditional-college-punishment-2/ http://www.iphods.com/videos/260144558810fa10a1d4feb4b1b1f7c6.m4v http://www.iphods.com/clips/thumbs/260144558810fa10a1d4feb4b1b1f7c6.jpg Traditional College Punishment #2 Simpkins is quite the disciplinarian as head schoolmaster. He is not one to relent at the first mournful cries of anguish. And these girls certainly are crying out in pain! As the limber cane rises and falls, their bottoms receive red welts. Are they repenting? Only time will tell. Simpkins will always have his cane at hand giving the girls swift cracks to the ass. 3 1 2009-07-08 Mature Adult Nogirlpainschoolmasterbottomalways http://www.iphods.com/movie/3/traditional-college-punishment-2/ http://www.iphods.com/videos/87f0e0041c5f8ce13149733c9f1910b7.m4v http://www.iphods.com/clips/thumbs/87f0e0041c5f8ce13149733c9f1910b7.jpg Traditional College Punishment #2 Simpkins is quite the disciplinarian as head schoolmaster. He is not one to relent at the first mournful cries of anguish. And these girls certainly are crying out in pain! As the limber cane rises and falls, their bottoms receive red welts. Are they repenting? Only time will tell. Simpkins will always have his cane at hand giving the girls swift cracks to the ass. 4.5 1 2009-07-08 Mature Adult Nogirlpainschoolmasterbottomalways http://www.iphods.com/movie/3/traditional-college-punishment-2/ http://www.iphods.com/videos/76dfd9a82394e53f8ef0ca0e2b36fcc0.m4v http://www.iphods.com/clips/thumbs/76dfd9a82394e53f8ef0ca0e2b36fcc0.jpg Traditional College Punishment #2 Simpkins is quite the disciplinarian as head schoolmaster. He is not one to relent at the first mournful cries of anguish. And these girls certainly are crying out in pain! As the limber cane rises and falls, their bottoms receive red welts. Are they repenting? Only time will tell. Simpkins will always have his cane at hand giving the girls swift cracks to the ass. 4 1 2009-07-08 Mature Adult Nogirlpainschoolmasterbottomalways http://www.iphods.com/movie/7/royal-rumble/ http://www.iphods.com/videos/9faa881bf87b57ab2c73d057ead11daa.m4v http://www.iphods.com/clips/thumbs/9faa881bf87b57ab2c73d057ead11daa.jpg Royal Rumble We've to ten outrageous scenes in this one of a kind collection of the hottest sexual smack-downs ever filmed and we're sure they will make you put a chokehold on your big Johnson! These girls mean business! The insatiable Troy Lane, the drop dead gorgeous Daisy Marie, and a whole tag team of sex hungry bitches are ripe and ready for those late night fuck parties, white hot lesbian encounters and mid blowing anal assaults that will make them scream and take them down for the count! 2.5 1 2009-07-08 Mature Adult Nogirlshottestfilmnightcreambitchesinsatiableblowcollectionbusiness http://www.iphods.com/movie/8/padded-cell/ http://www.iphods.com/videos/fa8b3b597a97814230761efdf9befe29.m4v http://www.iphods.com/clips/thumbs/fa8b3b597a97814230761efdf9befe29.jpg Padded Cell CANT DOG PRODUCTIONS introduces you to the breath taking Anna Peak and her submissive transgendered captive Idios. They invite you to witness the experience that is known as the "Padded Cell". The pair are completely secluded and you will observe the bizarre and visually striking imagery of a horny femme top playing with this animal-like creature. The film is entirely silent except for her screams of lust and her toy's cooing gas mask grunts, and a couple smacks while unraveling insatiable sensations! Enter the padded cell and let yourself go, if you dare. 3 1 2009-07-08 Mature Adult Noexperiencehornyfilmsubmissiveinsatiablecompletelycouplebizarrecompletepair http://www.iphods.com/movie/9/mayhem-at-the-mansion/ http://www.iphods.com/videos/12e821273c6abf702071cc644fe8094a.m4v http://www.iphods.com/clips/thumbs/12e821273c6abf702071cc644fe8094a.jpg Mayhem At The Mansion When Mistress Real decides to throw a lavish party at her countryside mansion, you just know it's going to be mayhem. This DOM Promotions adult fetish fantasy special, stars a whole host of characters from Hans the idiotic German butler, to the transvestite sluts that walk the streets of the village. When things don't go the Mistresses' way, there is only one type of punishment on offer! Plenty of spanking and paddling to make nice sore bottoms and then, before the party can get into full swing, Mistress needs to test the cock-sucking skills of her new sissy TV's. As you know, you can never have too many cock suckers at a party. 3.5 1 2009-07-08 Mature Adult Nospankingpunishmentsuckingpartymistressniceslutbottomfantasyadultmistressesdecide http://www.iphods.com/movie/9/mayhem-at-the-mansion/ http://www.iphods.com/videos/39b1226e5edfdd11c424cb06420dc71f.m4v http://www.iphods.com/clips/thumbs/39b1226e5edfdd11c424cb06420dc71f.jpg Mayhem At The Mansion When Mistress Real decides to throw a lavish party at her countryside mansion, you just know it's going to be mayhem. This DOM Promotions adult fetish fantasy special, stars a whole host of characters from Hans the idiotic German butler, to the transvestite sluts that walk the streets of the village. When things don't go the Mistresses' way, there is only one type of punishment on offer! Plenty of spanking and paddling to make nice sore bottoms and then, before the party can get into full swing, Mistress needs to test the cock-sucking skills of her new sissy TV's. As you know, you can never have too many cock suckers at a party. 3 1 2009-07-08 Mature Adult Nospankingpunishmentsuckingpartymistressniceslutbottomfantasyadultmistressesdecide http://www.iphods.com/movie/14/2-holes-1-pole-vol-2-disc-2/ http://www.iphods.com/videos/68422f1f817df1134d860c5df0a39b12.m4v http://www.iphods.com/clips/thumbs/68422f1f817df1134d860c5df0a39b12.jpg 2 Holes 1 Pole Vol. 2 (Disc 2) 2 Disc Collector's Edition. It's every man's fantasy to fuck two girls at the same time, so we've made it possible with this special 2-disc set that features some hot and steamy double team action! Watch as Karina Kay, Sunny Lane, Leah Livingston, Kiki Vidis, Ashley Jensen, Lana Croft, and more hot chicks take turns sucking and fucking a rock hard cock! You won't want to miss this absurdly hot episode because these girls love to show their guys a good time, two at a time! 2 1 2009-07-01 Mature Adult Nolovefuckingsuckingguysdoubleverysuckchicksashleysteamyfantasyrock hardhard cockchickfeaturetwo girls http://www.iphods.com/movie/19/tickle-his-balls-and-make-him-cum/ http://www.iphods.com/videos/ef74003fdddae53c1a9835b1e8cb50fb.m4v http://www.iphods.com/clips/thumbs/ef74003fdddae53c1a9835b1e8cb50fb.jpg Tickle His Balls And Make Him Cum This new one is AWESOME. With Laney in charge she made Elaine stroke this ticklephiles cock and even suck it a little till he blew a big load and they tickled him thru the whole video! The poor guy was going CRAZY with laughter and pleasure at the same time. It's been a while since we made a video like this but well worth the wait. You are going to LOVEit! No part was spared and his feet sides and balls really got hammered! 3.5 1 2009-07-01 Mature Adult Nococklovepleasureballsvideoeventicklepoorball http://www.iphods.com/movie/23/luscious-girls/ http://www.iphods.com/videos/b4d20b5bc23a97f6ccbe4b85bb045a3b.m4v http://www.iphods.com/clips/thumbs/b4d20b5bc23a97f6ccbe4b85bb045a3b.jpg Luscious Girls Mischievous minx Silvie embarks on her first ever girl-girl experience in Luscious Girls with sexy elfin Carly. It's the morning after and Silvie tries to sneak out, but Carly drags her back so they can passionately taste each other. With furious rubbing and desperate gasps, Carly, face flushed and legs trembling, is quick to covet what is hers. Shall we go out or stay in? Silvie knows there's no such thing as a quiet night in at Kiki's place. And that's exactly what Silvie wants. After teasing Kiki with a playful strip, Silvie shyly explores Kiki's delicious breast with her tongue, then pins Kiki to the floor. Kiki writhes and whimpers with every touch, but this isn't enough to sate Kiki's ravenous hunger. Exotic temptresses Silvie and Kiki revel in Luscious Girls with a sizzling cascade of moist orgasms. 5 1 2009-06-26 Mature Adult Nosexyexperienceplayorgasmorgasmstonguelegsnightteasingpassionatefloor http://www.iphods.com/movie/28/the-naughty-little-school-girl/ http://www.iphods.com/videos/952c7114801767ccefc98e3fcd87e1da.m4v http://www.iphods.com/clips/thumbs/952c7114801767ccefc98e3fcd87e1da.jpg The Naughty Little School Girl Rayne is delivered to Ashleigh to be disciplined after a rash of naughty behavior. Her first step is to restrain the young bitch and inform her of who is in charge with a bottom spanking. Rayne tries to get loose and must be bound and gagged in various states of undress until fully nude. At one point she and Ashleigh get into a scrap that ends up with Ashleigh on top and Rayne in a choke hold. In the end Ashleigh decides that Rayne needs her bottom cleaned out and administers a nice rush of cold water. Incredibly gorgeous and tattoo free body on cute girl Rayne. 5 1 2009-06-26 Mature Adult Nospankinggirlyoungbodynicebottomgaggednaughtycutecleanendsdecidefree http://www.iphods.com/movie/30/somas-cuckold-bitch/ http://www.iphods.com/videos/ee4e5e7aeaababfe16ac49c1708670ef.m4v http://www.iphods.com/clips/thumbs/ee4e5e7aeaababfe16ac49c1708670ef.jpg Soma's Cuckold Bitch Cuckold role play with Soma Snakeoil, Jimmy Broadway, and Alex Astor. Jimmy's had a bad day. And it's about to get worse! While he's been hard at work, his friend Alex has been hard at home- showing Jimmy's wife Soma what a real man is like. But now that Jimmy has been laid off, Soma has a choice- Alex's mighty python or Jimmy's little worm. When Soma starts sucking Alex's cock, her choice becomes obvious. How far will Jimmy let Soma go? What's more important to him, his dignity or his wife's happiness? Jimmy is humiliated as he's forced to watch Soma suck Alex's big cock and fuck him in several positions! Jimmy has to watch as his wife cums on his co-workers cock while she has him lick her shows and uses him as a pathetic armrest! Poor Jimmy! Done with Alex, Jimmy and Soma have a little char-things are going to change, and for starters, she's going to use Jimmy as her little fuck-toy, and her dildo is much larger than Jimmy's worm cock. 3 1 2009-06-26 Mature Adult Nococksuckingforcedplaydildowifepositionscumspoorpositionlarge http://www.iphods.com/movie/32/bisexual-nature-hike/ http://www.iphods.com/videos/139ba83b4c86daae2b606ec330b62061.m4v http://www.iphods.com/clips/thumbs/139ba83b4c86daae2b606ec330b62061.jpg Bisexual Nature Hike There's nothing like a nature hike in the great outdoors with your lady and best friends. When the girls get horny, one cock in not enough and it apparently is not enough for the guys as well. These hot collegiate babes and studs get it on in manage a trios action that eventually results in a hot dude eating pussy while his bro pounds his tight 19-year-old hole! Grab your butterfly net, it's time for a BISEXUAL NATURE HIKE! 3 1 2009-06-26 Mature Adult Nococktighthornyguysstudsevenfriendsbuttdoorbisexualladyendseventually http://www.iphods.com/movie/35/acting-out/ http://www.iphods.com/videos/34d25501de5fa95114a03e4fcbbd6323.m4v http://www.iphods.com/clips/thumbs/34d25501de5fa95114a03e4fcbbd6323.jpg Acting Out Newly enrolled in the Bo Edwards School of Porn, where homeroom is in the bedroom, Mercedez takes too many units and finds that she's totally jammed and she's graded on the curves. But despite her tight schedule, she works long and hard enough to get an A+ in sexual education! After you see the sexy lesbian action in scene 2 and the foursome in scene 4, I think you'll agree she deserved an A+! 2 1 2009-06-19 Mature Adult Nolesbiantightschoolsexualpornfourbedroomworks http://www.iphods.com/movie/39/isis-love-her-fuck-slut-giggles/ http://www.iphods.com/videos/b5850d3381c1b388f7b8e44d8023ff07.m4v http://www.iphods.com/clips/thumbs/b5850d3381c1b388f7b8e44d8023ff07.jpg Isis Love and Her Fuck Slut Giggles Come and see Isis Love and Her Fuck Slut Giggles. In the opening scene see how Mistress Isis scolds Giggles for smiling and laughing, soon she'll have nothing to smile about as she's forced to wear a blindfold and be disciplined. Next Giggles is bound and Isis places clothespins all over her slave's body including her tongue. Finally see how cock tease Giggles get's bound and fucked by her sexy lesbian mistress Isis Love. 4.5 1 2009-06-19 Mature Adult Nococksexyboundbodymistressforcedfinallytongueslutclothes http://www.iphods.com/movie/40/pussy-trainer/ http://www.iphods.com/videos/2249eeb56cfa4990ecbb13eb2902f87f.m4v http://www.iphods.com/clips/thumbs/2249eeb56cfa4990ecbb13eb2902f87f.jpg Pussy Trainer This film is loaded with nearly every sex act under the sun, from extreme penetrations to anal sex to double penetration to strap-on sex and sucking. Watch the last scene, which is not to be missed, with a girl and two guys who are gradually joined by more people until there's an all out orgy! 4 1 2009-06-19 Mature Adult Nosuckingguysdoubleverysuckanaljoinorgyextremepenetration http://www.iphods.com/movie/41/forced-bi-cuckolds-2/ http://www.iphods.com/videos/40eaaa0a5af72a5b75a0cba954989a92.m4v http://www.iphods.com/clips/thumbs/40eaaa0a5af72a5b75a0cba954989a92.jpg Forced Bi Cuckolds 2 Granted, the topic of one man sucking another man's cock isn't your ordinary cocktail party conversation starter. To see what I mean, try this on someone: "My wife brought this guy home the other night, and I sucked his balls..." Like, how do you react to that? Start off with this nugget, and, guaranteed, you're going to clear the room. That's why for the sake of enlightenment, as many people as possible need to view this movie. So next time the discussion gets around to dick, you'll be prepared with something equally provocative to say, like, "Oh, and how did it taste?" 3.5 1 2009-06-19 Mature Adult Nodicksuckingpartyballsnightwifeballview http://www.iphods.com/movie/41/forced-bi-cuckolds-2/ http://www.iphods.com/videos/7bb315dcfbfd754ec93775a4ef04b764.m4v http://www.iphods.com/clips/thumbs/7bb315dcfbfd754ec93775a4ef04b764.jpg Forced Bi Cuckolds 2 Granted, the topic of one man sucking another man's cock isn't your ordinary cocktail party conversation starter. To see what I mean, try this on someone: "My wife brought this guy home the other night, and I sucked his balls..." Like, how do you react to that? Start off with this nugget, and, guaranteed, you're going to clear the room. That's why for the sake of enlightenment, as many people as possible need to view this movie. So next time the discussion gets around to dick, you'll be prepared with something equally provocative to say, like, "Oh, and how did it taste?" 3 1 2009-06-19 Mature Adult Nodicksuckingpartyballsnightwifeballview http://www.iphods.com/movie/47/barely-legal-90/ http://www.iphods.com/videos/6357f3fed09e62d1b800f8eb4e410cda.m4v http://www.iphods.com/clips/thumbs/6357f3fed09e62d1b800f8eb4e410cda.jpg Barely Legal 90 These barely legal babes are fresh out of school, and ready to tap into their inner slut! Candi's pussy displays a "can do" attitude; meanwhile Tanner gets a poolside poke. Stephanie is primed and ready to fuck it out and Nikki grabs hold and samples some big dick. And coming in last, Michelle bends over for full cock-contact! 2 1 2009-06-12 Mature Adult Nopussyschooldickplaysluthellbaremichellestephaniepoolends http://www.iphods.com/movie/53/lesbian-psycho-roommates/ http://www.iphods.com/videos/4281f80c3632531eaeb91ff3145a2cf8.m4v http://www.iphods.com/clips/thumbs/4281f80c3632531eaeb91ff3145a2cf8.jpg Lesbian Psycho Roommates Elexis needs a new place to live, and lesbian couple Misty and Lindsey have a beautiful room for rent. But what happened to the girls' previous roommate, and why are her clothes still hanging in the closet? Elexis quickly grows suspicious of the gorgeous blonde and brunette. Has the sinister young couple finally picked the wrong victim? Unexpected twists and turns take the viewer on a ride of seduction, deception, and sweet revenge. 3 1 2009-06-04 Mature Adult Noyoungbeautifullesbianfinallyblondebrunetteridecoupleclothesviewcloserevenge http://www.iphods.com/movie/59/cuckold-fantasies-vol-12/ http://www.iphods.com/videos/da35684e5b08fda49318e134aa1eb2b8.m4v http://www.iphods.com/clips/thumbs/da35684e5b08fda49318e134aa1eb2b8.jpg Cuckold Fantasies Vol. 12 How much cum can one unlucky husband consume? Would you believe 5 GOOEY LOADS? Gorgeous blonde wife Holly Foxxx masturbates in up-close POV as she yearns for a BIG COCK to fill her neglected pussy. She tells you just how pathetic her worthless husband is and how tiny his dick is. She releases husband Jimmy from the under-the-stairs cubbyhole where he's forced to sleep, and makes him WORSHIP HER ASS AND PUSSY. She torments him and his CHASTITY DEVICE bound penis, before sending him off to work. While her wimpy husband is away, Holly invites studly lover Shane over for the afternoon. As they KISS deeply, she rips down his pants to reveal a MASSIVE ERECTION! She praises his cock as she runs her hands over it and finally takes it in her mouth. Husband Jimmy returns to find his wife giving this stranger a BLOWJOB. She orders him to undress and kiss her feet while she services this real man. Bewildered wuss that he is, Jimmy complies. He can only watch helplessly as Holly's mouth is stretched by this clearly sup 5 1 2009-06-04 Mature Adult Nopussytightboundpainhandsdickdeepforcedfinallyblondefeetmouthkisswifemassivehusbandblowreleasecontinuesloverhelplessballcloselucky http://www.iphods.com/movie/68/where-theres-smoke-ii-another-smoking-sex-fantasy/ http://www.iphods.com/videos/f4b782d2a57828123f15fa3ce8d88416.m4v http://www.iphods.com/clips/thumbs/f4b782d2a57828123f15fa3ce8d88416.jpg Where There's Smoke II - Another Smoking Sex Fantasy The queen of hardcore smoking sex fetish is back with another collection of brand new scenes that are sure to fuel your every addiction! No one nails the smoking sex fetish like Marie Madison!. Six brand new scenes including the smash VOD hit "The Ritual" available for the first time on DVD! 2.5 1 2009-05-29 Mature Adult Nohardcorefetishsmokingfirst timecollectionqueen http://www.iphods.com/movie/68/where-theres-smoke-ii-another-smoking-sex-fantasy/ http://www.iphods.com/videos/62c6641ebfa9f163aefe3f6492133afa.m4v http://www.iphods.com/clips/thumbs/62c6641ebfa9f163aefe3f6492133afa.jpg Where There's Smoke II - Another Smoking Sex Fantasy The queen of hardcore smoking sex fetish is back with another collection of brand new scenes that are sure to fuel your every addiction! No one nails the smoking sex fetish like Marie Madison!. Six brand new scenes including the smash VOD hit "The Ritual" available for the first time on DVD! 3.5 1 2009-05-29 Mature Adult Nohardcorefetishsmokingfirst timecollectionqueen http://www.iphods.com/movie/77/moms-a-cheater-5/ http://www.iphods.com/videos/51bd96dc09c08215def1dbf5cfd071b5.m4v http://www.iphods.com/clips/thumbs/51bd96dc09c08215def1dbf5cfd071b5.jpg Mom's A Cheater 5 You thought your best friend's mom was a goody two shoes? Well, THINK AGAIN! Watch hot, sexy MILFs (Mothers I'd Love To Fuck) run around like wild cock hounds! These sexy moms are fucking like wild animals and cheating on their loser husbands! These MILFs do not let their age slow them down a bit! Enjoy! 3.5 1 2009-05-29 Mature Adult Nofuckinghusbandmomsmilfmilfsshoes http://www.iphods.com/movie/80/risque-girls/ http://www.iphods.com/videos/822bce7cd62c1dcbca6190bb24337cc4.m4v http://www.iphods.com/clips/thumbs/822bce7cd62c1dcbca6190bb24337cc4.jpg Risque Girls Provocative, sultry, and exciting. Risque Girls from Australian website abbywinters.com breaks away from the standard girl-girl scenes to feature a unique all-girl THREESOME! Three stunning knockouts, three needing pussies, and multiple earth-shattering orgasms! Chloe and Larissa act as sexual muses for Kiki, obediently following her dirty orders while she eagerly watches on. It's not too long before Kiki's passion erupts and she squeezes herself between her friends' naked bodies, forcing them to pay her some much-needed, naughty attention. With some casual, flirty suggestions and a few light touches, the attraction between Kara and Keilyn is instant and obvious. Their passion, energy and enthusiasm deliver these two lovers orgasm after orgasm. Making love the way they want-no script, no instruction, and no direction, this video perfectly captures hot girl-girl action abbywinters.com is renowned for! 4 1 2009-05-21 Mature Adult Nogirlsexualorgasmorgasmsthreefriendsdirtynaughtyeagerlarissakeilynloverslovernakedwatchesends http://www.iphods.com/movie/85/class-of-99/ http://www.iphods.com/videos/d0f971c545493e69420ce59a96dfe087.m4v http://www.iphods.com/clips/thumbs/d0f971c545493e69420ce59a96dfe087.jpg Class Of '99 At the local college, Fiona Fines a star pupil has been laboriously painting her latest masterpiece. Miss Day, the head teacher enters in a fuss, and accuses her of stealing a watch. Fiona denies any knowledge of the event, but there is evidence stacked against her. The watch had been found in her locker. Mrs. Day soon looses patience with Fiona's denials and orders her to the common room for punishment. Therein follows the usual course set down for punishment curriculums. A sound hand spanking followed by a caning from the school rod. The cane leaves its customary welts and the young woman leaves in tears. Mrs. Day feels extremely guilty, though, when she finds out that the watch was indeed places in the locker by another person. In our second story Mr. Cooper finds the naughtiest girl in the school in the gentleman's toilets. Three times this has happened and all within an hour! She is sent to Mrs. Day's office for a severe caning, and of course receives a hand spanking on her curvy bottom. 4 1 2009-05-21 Mature Adult Nospankingpunishmentpainschoolcaningmasterwomanbottomthreesecondofficestoryextremeteacherleavessevere http://www.iphods.com/movie/86/torturing-trixie/ http://www.iphods.com/videos/6a47d3957f7c59aaeabc134fdba5cab6.m4v http://www.iphods.com/clips/thumbs/6a47d3957f7c59aaeabc134fdba5cab6.jpg Torturing Trixie Trixie likes to be punished and tortured and Greg likes to grant her fantasies. Greg has fun beating her ass with his hand, flogger and crop. Trixie is caged and made to clean the house bound and chained, she has painful clothespins applied to her tits and hot wax on her bare back. They take a trip out on a lake just so Trixie can shave her pussy in the middle of it. In the end, Trixie will have a butt load of bruises to remember this video by. 4 1 2009-05-21 Mature Adult Nopussytitsboundpainvideotorturebuttbarecleanfantasiesclothes http://www.iphods.com/movie/88/discipline-of-amanda-punishment-of-sula/ http://www.iphods.com/videos/e0c40e8564ecb9eac8a4ab29c46bcfd0.m4v http://www.iphods.com/clips/thumbs/e0c40e8564ecb9eac8a4ab29c46bcfd0.jpg Discipline Of Amanda and Punishment Of Sula As one of the disciplinarians at the theatrical arts school, Sir Nik is always on the lookout for naughty young women! Threatening to take her scholarship unless she conforms to his discipline, Amanda is first to receive an over the knee spanking. Placing her in multiple positions, a red leather strap, hairbrush, wooden paddles, and the cane are used to place red welts on her soft white bottom. Later that evening it's Sula's turn to enter Sir Nik's Discipline Quarters where she is told that she was spotted at one of the local strip clubs stripping for money. This is not the proper behavior for such a distinguished school. Leather straps, wooden paddles, and the swishy cane are also applied to Sula's pale bottom. 5 1 2009-05-21 Mature Adult Nospankingschoolleatherwhitebottomnaughtyropealwaysusedhairpaddlepositionshairbrushposition http://www.iphods.com/movie/91/ron-jeremy-the-lost-footage-/ http://www.iphods.com/videos/9a6d2c7d20465d9e243bd0e81c7aaa2f.m4v http://www.iphods.com/clips/thumbs/9a6d2c7d20465d9e243bd0e81c7aaa2f.jpg Ron Jeremy - The Lost Footage From Deep in the vault comes the lost footage of one of the most well known male performers, Ron Jeremy! That's right, that legendary cock is back with never before seen footage! Join Ron as he fucks some of the hottest ass of the 70's and 80's porn era, where the ass was tight and the ladies would do anything for a man of his endowment and longevity! The hedgehog in his prime and glory. 4.5 1 2009-05-15 Mature Adult Notightladieshottestdeepanythingfootfucksfootagejoinjeremymale http://www.iphods.com/movie/94/transsexual-beauty-queens-kinky-taboo/ http://www.iphods.com/videos/7fcb9314ed1344981780b95c63be4f7c.m4v http://www.iphods.com/clips/thumbs/7fcb9314ed1344981780b95c63be4f7c.jpg Transsexual Beauty Queens - Kinky Taboo Follow these beautiful he-shes as they play with their willing boyfriends. To be sure...there's lots of dick suckin' and hot ass fuckin' from everyone even the boyfriends are involved in on the action too. No hole's off limits but they definitely get stretched to the limit! Seven scenes of raunchy, kinky she-male nastiness! 4.5 1 2009-05-14 Mature Adult Nodicksuckevenplaykinkyboyfriendfriendswillingmaleends http://www.iphods.com/movie/94/transsexual-beauty-queens-kinky-taboo/ http://www.iphods.com/videos/b8401175bdc50b1a61629a92885b2f21.m4v http://www.iphods.com/clips/thumbs/b8401175bdc50b1a61629a92885b2f21.jpg Transsexual Beauty Queens - Kinky Taboo Follow these beautiful he-shes as they play with their willing boyfriends. To be sure...there's lots of dick suckin' and hot ass fuckin' from everyone even the boyfriends are involved in on the action too. No hole's off limits but they definitely get stretched to the limit! Seven scenes of raunchy, kinky she-male nastiness! 5 1 2009-05-14 Mature Adult Nodicksuckevenplaykinkyboyfriendfriendswillingmaleends http://www.iphods.com/movie/94/transsexual-beauty-queens-kinky-taboo/ http://www.iphods.com/videos/e6598e083c74ca5147f11004344f3991.m4v http://www.iphods.com/clips/thumbs/e6598e083c74ca5147f11004344f3991.jpg Transsexual Beauty Queens - Kinky Taboo Follow these beautiful he-shes as they play with their willing boyfriends. To be sure...there's lots of dick suckin' and hot ass fuckin' from everyone even the boyfriends are involved in on the action too. No hole's off limits but they definitely get stretched to the limit! Seven scenes of raunchy, kinky she-male nastiness! 2 1 2009-05-14 Mature Adult Nodicksuckevenplaykinkyboyfriendfriendswillingmaleends http://www.iphods.com/movie/98/stand-corrected/ http://www.iphods.com/videos/a792bc947b0860e14b51ae65d6fcaacb.m4v http://www.iphods.com/clips/thumbs/a792bc947b0860e14b51ae65d6fcaacb.jpg Stand Corrected An impertinent editor is sternly reproved and severely punished by her employer, a respected fetish author, who learns that she has included her own (comic) footnotes in his serious erotic manuscript, turning the final draft into a satire, and sending it to press without his approval. Erica doesn't think that what she did was wrong so Devlin has his work cut out for him. The objective of the first scene: a sincere apology from his insulting employee. Fueled by indignation, Devlin wields his arm tirelessly. Somehow he has to make the unrepentant Erica understand that she has broken every rule in the book by taking such liberties with his text. (Good luck, Devlin!) Scene Two: Seeing that Erica learned nothing from her first spanking, Devlin doubles the over the knee discipline, adding in a stinging strapping for good measure. Teeming with witty invective, well deserved, extra hard spanking and relevant psychological insights, Stand Corrected, The Video will be appreciated by spanking enthusiasts on many level 4 1 2009-05-14 Mature Adult Nospankingdoublevideoverydoesfootfetisheroticlearnextraseverefans http://www.iphods.com/movie/98/stand-corrected/ http://www.iphods.com/videos/a923df0c263ea5af755601fb53e1bfe4.m4v http://www.iphods.com/clips/thumbs/a923df0c263ea5af755601fb53e1bfe4.jpg Stand Corrected An impertinent editor is sternly reproved and severely punished by her employer, a respected fetish author, who learns that she has included her own (comic) footnotes in his serious erotic manuscript, turning the final draft into a satire, and sending it to press without his approval. Erica doesn't think that what she did was wrong so Devlin has his work cut out for him. The objective of the first scene: a sincere apology from his insulting employee. Fueled by indignation, Devlin wields his arm tirelessly. Somehow he has to make the unrepentant Erica understand that she has broken every rule in the book by taking such liberties with his text. (Good luck, Devlin!) Scene Two: Seeing that Erica learned nothing from her first spanking, Devlin doubles the over the knee discipline, adding in a stinging strapping for good measure. Teeming with witty invective, well deserved, extra hard spanking and relevant psychological insights, Stand Corrected, The Video will be appreciated by spanking enthusiasts on many level 4 1 2009-05-14 Mature Adult Nospankingdoublevideoverydoesfootfetisheroticlearnextraseverefans http://www.iphods.com/movie/102/the-golden-age-of-bi-porn-2/ http://www.iphods.com/videos/4176ed894e1cd72e332f5929b5c47c8e.m4v http://www.iphods.com/clips/thumbs/4176ed894e1cd72e332f5929b5c47c8e.jpg The Golden Age Of Bi Porn 2 The Golden Age of Porn paved the way for the acceptance of bi-sexuality! If you love classic porn and you love men and women at play then you'll enjoy watching and wanking to The Golden Age of Porn: Volume 2. Between the sucking, ass play and bi-banging you'll have more on (or is that in?) your hands than you'll know what to do with. 2.5 1 2009-05-14 Mature Adult Nolovehandssuckingsexualwomenclassicbang http://www.iphods.com/movie/106/english-discipline-series-the-riding-stable-two-corrected-fillies/ http://www.iphods.com/videos/22570449875bc161b40d90774fdbc7c2.m4v http://www.iphods.com/clips/thumbs/22570449875bc161b40d90774fdbc7c2.jpg English Discipline Series - The Riding Stable/Two Corrected Fillies This film is about Charlotte and Jane's time at their father's best friend's stable. The two very attractive girls soon fall foul of the rules and the man in charge takes the girls to the tack room for some over the knee hand spanking on their bare bottoms. This is followed by a hard stable strap and his leather belt to further ensure discipline in the stable yard. Finally, the girls are horrified to see him reach for a swishy cane which is used to good effect by leaving tramlines across their gorgeous bare bottoms. 5 1 2009-05-07 Mature Adult Nogirlsspankingleatherfinallyfilmverybottomusedbaretable http://www.iphods.com/movie/106/english-discipline-series-the-riding-stable-two-corrected-fillies/ http://www.iphods.com/videos/953733c417db4b5396eb46c5b0a48692.m4v http://www.iphods.com/clips/thumbs/953733c417db4b5396eb46c5b0a48692.jpg English Discipline Series - The Riding Stable/Two Corrected Fillies This film is about Charlotte and Jane's time at their father's best friend's stable. The two very attractive girls soon fall foul of the rules and the man in charge takes the girls to the tack room for some over the knee hand spanking on their bare bottoms. This is followed by a hard stable strap and his leather belt to further ensure discipline in the stable yard. Finally, the girls are horrified to see him reach for a swishy cane which is used to good effect by leaving tramlines across their gorgeous bare bottoms. 2 1 2009-05-07 Mature Adult Nogirlsspankingleatherfinallyfilmverybottomusedbaretable http://www.iphods.com/movie/110/my-college-porno/ http://www.iphods.com/videos/84978a4187ed0729f5296010af37320e.m4v http://www.iphods.com/clips/thumbs/84978a4187ed0729f5296010af37320e.jpg My College Porno We have been contacted by several wannabe filmmakers for their chance to direct and star in their first ever porn scene. They designed the fantasy, the picked the porn star, and starred in their first XXX scene. So watch these amateurs take control because you never know... You could be next! 3.5 1 2009-05-07 Mature Adult Nopornamateurfantasy http://www.iphods.com/movie/112/cuckold-milfs-4-/ http://www.iphods.com/videos/7c2b63bd8322c4ba0f039265318b667e.m4v http://www.iphods.com/clips/thumbs/7c2b63bd8322c4ba0f039265318b667e.jpg Cuckold MILFS 4 Remember when fucking your wife was a good time? Of course you don't. That was 20 years and 30 pounds ago. Of course, that bloated freeloader still expects you to pay the bills and fuck her blown out baby-hole. Screw that. It's time to fuck hookers and teens! Time to pay negroes to pollute her womb. What's she gonna do? Leave? You're not that lucky! Desi Foxx, Kirra Lynne and Vannah Sterling are a little past their prime, but that doesn't stop hung studs from fucking them for their paying husbands. 2 1 2009-05-07 Mature Adult Nofuckingstudsdoeswifehusbandblowlynnluckyfree http://www.iphods.com/movie/112/cuckold-milfs-4-/ http://www.iphods.com/videos/3c6b52fed48fb7f57233514d177d72c6.m4v http://www.iphods.com/clips/thumbs/3c6b52fed48fb7f57233514d177d72c6.jpg Cuckold MILFS 4 Remember when fucking your wife was a good time? Of course you don't. That was 20 years and 30 pounds ago. Of course, that bloated freeloader still expects you to pay the bills and fuck her blown out baby-hole. Screw that. It's time to fuck hookers and teens! Time to pay negroes to pollute her womb. What's she gonna do? Leave? You're not that lucky! Desi Foxx, Kirra Lynne and Vannah Sterling are a little past their prime, but that doesn't stop hung studs from fucking them for their paying husbands. 4 1 2009-05-07 Mature Adult Nofuckingstudsdoeswifehusbandblowlynnluckyfree http://www.iphods.com/movie/113/oh-no-theres-a-negro-in-my-wife-2/ http://www.iphods.com/videos/5f1d777822a24f71316eabaa1374e98e.m4v http://www.iphods.com/clips/thumbs/5f1d777822a24f71316eabaa1374e98e.jpg Oh No! There's A Negro In My Wife! 2 It's not easy for you to accept the fact that your wife is fucking a Negro. Her stretched out holes keep you from achieving an orgasm and the fried chicken crumbs on the bed just add insult to the injury. But, what troubles you most is watching her kiss your kids goodnight. If they only knew the disgusting black log those lips were wrapped around an hour ago. Maybe you should do them a favor and smother them as they sleep tonight. 3.5 1 2009-05-07 Mature Adult Nofuckingblackorgasmnightkissholeswifelipschick http://www.iphods.com/movie/114/home-made-bottom-boys/ http://www.iphods.com/videos/1e500459805f3c372e01d8c1c06d2237.m4v http://www.iphods.com/clips/thumbs/1e500459805f3c372e01d8c1c06d2237.jpg Home Made Bottom Boys Amateur guys want to find out what it's like having a dildo shoved in their ass. All New guys never before on camera! 5 guys interested in testing out having a dildo shoved in their asses for the first time. They all go pay Kelly Devine a visit, because she is a specialist when it comes to putting her strap on inside of guy's virgin assholes. Let's see if these guys will enjoy the ass pounding! 5 1 2009-05-07 Mature Adult Noguyspoundingkellyholesamateurassholesfirst timeassholeasses http://www.iphods.com/movie/115/bondage-squirters-3/ http://www.iphods.com/videos/c4185bc567a1ef2c14359ef805816b2d.m4v http://www.iphods.com/clips/thumbs/c4185bc567a1ef2c14359ef805816b2d.jpg Bondage Squirters 3 The hottest, sexiest and wettest bondage series continues with Maxine X and her squirting sluts in Bondage Squirters #3! This edition features the incomparable Jada Fire gushing and squirting hot pussy juice while helplessly bound spread-eagle and gagged. Sweet and sexy Jamie James is tied to the bondage sex chair and is made to cum to squirting orgasms over and over again. Maxine X also gets in on the wet action as she squirts buckets of pussy juice while bound in tight rope bondage. If you like to see the hottest, sexiest most beautiful squirters bound and forced to gush to wet orgasms, then this latest installment in the Bondage Squirters from Maxine X Productions is for you! 5 1 2009-05-07 Mature Adult Nopussysexybondagebeautifultightboundhottesttiedforcedorgasmorgasmsgaggedropehairsquirtingsexiestsquirtcontinuesspreadfeaturehelpless http://www.iphods.com/movie/115/bondage-squirters-3/ http://www.iphods.com/videos/6bf7553e6c94c4ea81022adbbb84d758.m4v http://www.iphods.com/clips/thumbs/6bf7553e6c94c4ea81022adbbb84d758.jpg Bondage Squirters 3 The hottest, sexiest and wettest bondage series continues with Maxine X and her squirting sluts in Bondage Squirters #3! This edition features the incomparable Jada Fire gushing and squirting hot pussy juice while helplessly bound spread-eagle and gagged. Sweet and sexy Jamie James is tied to the bondage sex chair and is made to cum to squirting orgasms over and over again. Maxine X also gets in on the wet action as she squirts buckets of pussy juice while bound in tight rope bondage. If you like to see the hottest, sexiest most beautiful squirters bound and forced to gush to wet orgasms, then this latest installment in the Bondage Squirters from Maxine X Productions is for you! 5 1 2009-05-07 Mature Adult Nopussysexybondagebeautifultightboundhottesttiedforcedorgasmorgasmsgaggedropehairsquirtingsexiestsquirtcontinuesspreadfeaturehelpless http://www.iphods.com/movie/116/goon-squad/ http://www.iphods.com/videos/1de273a949d196c0acd55a32037b9852.m4v http://www.iphods.com/clips/thumbs/1de273a949d196c0acd55a32037b9852.jpg Goon Squad This is the first new release from ZFX in 3 years. This title has not yet been released on DVD and it is not available anywhere else. It is being made available here, exclusively, for a limited time. After a devastating terrorist attack, the United States is plunged into a perpetual state of conflict by corrupt leaders with the ambiguous goal of wiping out world terrorism. The real agenda is much darker. This was THE moment that the power hungry opportunists had waited for. Using division and fear, the Constitution is secretly suspended through the ironically named "Freedom Act". Anyone who opposes is branded sympathetic to terrorists. Buried deep within its vile text are the funding and legal basis to form vigilante spy groups to suppress political opposition at a local level. All forms of communication are secretly monitored. Widespread surveillance is authorized. Anyone who openly opposes the conflict is labeled a "terrorist" and secretly rounded up for extra-judicial interrogation and detentio 5 1 2009-05-07 Mature Adult Nofoottorturegroupsecretuseddarkextrastorycallreleasespreadpowerpositioncampfree http://www.iphods.com/movie/116/goon-squad/ http://www.iphods.com/videos/59302acea75229b4ff83b63843ed326d.m4v http://www.iphods.com/clips/thumbs/59302acea75229b4ff83b63843ed326d.jpg Goon Squad This is the first new release from ZFX in 3 years. This title has not yet been released on DVD and it is not available anywhere else. It is being made available here, exclusively, for a limited time. After a devastating terrorist attack, the United States is plunged into a perpetual state of conflict by corrupt leaders with the ambiguous goal of wiping out world terrorism. The real agenda is much darker. This was THE moment that the power hungry opportunists had waited for. Using division and fear, the Constitution is secretly suspended through the ironically named "Freedom Act". Anyone who opposes is branded sympathetic to terrorists. Buried deep within its vile text are the funding and legal basis to form vigilante spy groups to suppress political opposition at a local level. All forms of communication are secretly monitored. Widespread surveillance is authorized. Anyone who openly opposes the conflict is labeled a "terrorist" and secretly rounded up for extra-judicial interrogation and detentio 4 1 2009-05-07 Mature Adult Nofoottorturegroupsecretuseddarkextrastorycallreleasespreadpowerpositioncampfree http://www.iphods.com/movie/117/wanna-fuck-my-wife-gotta-fuck-me-too/ http://www.iphods.com/videos/ab5e9602dbde0be13a25b7aa3be6d286.m4v http://www.iphods.com/clips/thumbs/ab5e9602dbde0be13a25b7aa3be6d286.jpg Wanna Fuck My Wife Gotta Fuck Me Too She's the hottest chick you've ever seen and you'll do anything to get some of that sweet pussy. Well my friend, you just might have to, because here's the deal. She'll let you fuck her all you want, but she wants to see you and her husband fuck too! Oh, did we mention that she has a big, mean strap-on all lubed up and ready for your skinny ass? This is one twisted threesome you can't pass up! Shot in HD Widescreen. 3.5 1 2009-05-07 Mature Adult Noanythingthreehusbandskinchick http://www.iphods.com/movie/117/wanna-fuck-my-wife-gotta-fuck-me-too/ http://www.iphods.com/videos/0dea383e9f91bb8986502ddebc299abe.m4v http://www.iphods.com/clips/thumbs/0dea383e9f91bb8986502ddebc299abe.jpg Wanna Fuck My Wife Gotta Fuck Me Too She's the hottest chick you've ever seen and you'll do anything to get some of that sweet pussy. Well my friend, you just might have to, because here's the deal. She'll let you fuck her all you want, but she wants to see you and her husband fuck too! Oh, did we mention that she has a big, mean strap-on all lubed up and ready for your skinny ass? This is one twisted threesome you can't pass up! Shot in HD Widescreen. 3 1 2009-05-07 Mature Adult Noanythingthreehusbandskinchick http://www.iphods.com/movie/118/by-appointment-only-8/ http://www.iphods.com/videos/8db486e42ba7403369a9a665917bdff1.m4v http://www.iphods.com/clips/thumbs/8db486e42ba7403369a9a665917bdff1.jpg By Appointment Only #8 Created by a Woman for Women. We're waiting for you! Share their desires, taste their passion, feel the sizzling excitement to their ultimate orgasms. Who couldn't resist watching two women tenderly caress each other's perky tits, and licking each other's pink, wet slits? Get ready to watch some of the most erotic lesbian scenes ever! 5 1 2009-04-30 Mature Adult Notitslesbianorgasmorgasmslickingultimate http://www.iphods.com/movie/121/young-girls-with-big-tits-volume-8-disc-1/ http://www.iphods.com/videos/d1b1ac9a316c9b13d0727b6663643c5f.m4v http://www.iphods.com/clips/thumbs/d1b1ac9a316c9b13d0727b6663643c5f.jpg Young Girls With Big Tits Volume 8 (Disc 1) 2 disc set. It's time to get your fill of fresh pussies and juicy jugs! Kagney Linn Karter, Ashlynn Brooke, Cassandra Calogera, Brandy Talore, Amy Ried, Sara Stone, Natasha Nice, and more busty young babes are here to rock your cock all night long. So watch their titties bounce all around as they grind their pussies all over your schlong. It doesn't get any better than fucking a hot young chick. Especially when she's got a pair of big hot tits! 4 1 2009-04-30 Mature Adult Nocockyoungtitsfuckingnicepussiesyour cocknightjuicyespeciallychicklynnbustypair http://www.iphods.com/movie/121/young-girls-with-big-tits-volume-8-disc-1/ http://www.iphods.com/videos/0080b7cfa099512955a15297b917f847.m4v http://www.iphods.com/clips/thumbs/0080b7cfa099512955a15297b917f847.jpg Young Girls With Big Tits Volume 8 (Disc 1) 2 disc set. It's time to get your fill of fresh pussies and juicy jugs! Kagney Linn Karter, Ashlynn Brooke, Cassandra Calogera, Brandy Talore, Amy Ried, Sara Stone, Natasha Nice, and more busty young babes are here to rock your cock all night long. So watch their titties bounce all around as they grind their pussies all over your schlong. It doesn't get any better than fucking a hot young chick. Especially when she's got a pair of big hot tits! 4.5 1 2009-04-30 Mature Adult Nocockyoungtitsfuckingnicepussiesyour cocknightjuicyespeciallychicklynnbustypair http://www.iphods.com/movie/125/smokin-pussy-party-3/ http://www.iphods.com/videos/726413fc91f02a1b6143c92a142e8723.m4v http://www.iphods.com/clips/thumbs/726413fc91f02a1b6143c92a142e8723.jpg Smokin Pussy Party 3 Cum and check out 6 "Smoking" hot babes in this lesbian, fetish -smoking, female orgy, dildo playing, cock sucking film that will leave you wet! These pussy eating babes will lick a pussy, suck a cock and play with themselves, and manage to smoke their brains out. They are quite the sex kittens with their shaved pussy's tattoo's and piercings! 5 1 2009-04-30 Mature Adult Nopussylesbiansuckingfilmfetishfemaledildoshavedsmokingsmokeorgymale http://www.iphods.com/movie/125/smokin-pussy-party-3/ http://www.iphods.com/videos/c0235d3389f97c6d8e617249fac6a6b0.m4v http://www.iphods.com/clips/thumbs/c0235d3389f97c6d8e617249fac6a6b0.jpg Smokin Pussy Party 3 Cum and check out 6 "Smoking" hot babes in this lesbian, fetish -smoking, female orgy, dildo playing, cock sucking film that will leave you wet! These pussy eating babes will lick a pussy, suck a cock and play with themselves, and manage to smoke their brains out. They are quite the sex kittens with their shaved pussy's tattoo's and piercings! 4.5 1 2009-04-30 Mature Adult Nopussylesbiansuckingfilmfetishfemaledildoshavedsmokingsmokeorgymale http://www.iphods.com/movie/125/smokin-pussy-party-3/ http://www.iphods.com/videos/b65dbc89b38bb8a59259fea7c23e515a.m4v http://www.iphods.com/clips/thumbs/b65dbc89b38bb8a59259fea7c23e515a.jpg Smokin Pussy Party 3 Cum and check out 6 "Smoking" hot babes in this lesbian, fetish -smoking, female orgy, dildo playing, cock sucking film that will leave you wet! These pussy eating babes will lick a pussy, suck a cock and play with themselves, and manage to smoke their brains out. They are quite the sex kittens with their shaved pussy's tattoo's and piercings! 2.5 1 2009-04-30 Mature Adult Nopussylesbiansuckingfilmfetishfemaledildoshavedsmokingsmokeorgymale http://www.iphods.com/movie/125/smokin-pussy-party-3/ http://www.iphods.com/videos/a0efff62ae507124fb9867d2030f3dfa.m4v http://www.iphods.com/clips/thumbs/a0efff62ae507124fb9867d2030f3dfa.jpg Smokin Pussy Party 3 Cum and check out 6 "Smoking" hot babes in this lesbian, fetish -smoking, female orgy, dildo playing, cock sucking film that will leave you wet! These pussy eating babes will lick a pussy, suck a cock and play with themselves, and manage to smoke their brains out. They are quite the sex kittens with their shaved pussy's tattoo's and piercings! 3 1 2009-04-30 Mature Adult Nopussylesbiansuckingfilmfetishfemaledildoshavedsmokingsmokeorgymale http://www.iphods.com/movie/128/lesbian-chronicles-volume-three/ http://www.iphods.com/videos/425ee5c29e83f151b8ab323e4a9f8576.m4v http://www.iphods.com/clips/thumbs/425ee5c29e83f151b8ab323e4a9f8576.jpg Lesbian Chronicles Volume Three The drama continues in the third episode of lesbian chronicles, as Nica opens an all-female massage parlor with her inheritance money. The only problem is, Nica suspects the masseuses are doing more than just "working out kinks." Will Nica find out why Trinity's sessions are so popular with rich client Stephanie Swift? What does young Annabelle have in mind for nervous first-timer Mia Laylani? Nica devises a plan with Jessica Bangkok to find out what her naughty employees are up to, but not before her own encounter with the strangely familiar Satine Phoenix. 3 1 2009-04-23 Mature Adult Noyounglesbianfemalenaughtystephaniemindcontinuesmalepopularbang http://www.iphods.com/movie/128/lesbian-chronicles-volume-three/ http://www.iphods.com/videos/84205557b340522a1441ef65643737ba.m4v http://www.iphods.com/clips/thumbs/84205557b340522a1441ef65643737ba.jpg Lesbian Chronicles Volume Three The drama continues in the third episode of lesbian chronicles, as Nica opens an all-female massage parlor with her inheritance money. The only problem is, Nica suspects the masseuses are doing more than just "working out kinks." Will Nica find out why Trinity's sessions are so popular with rich client Stephanie Swift? What does young Annabelle have in mind for nervous first-timer Mia Laylani? Nica devises a plan with Jessica Bangkok to find out what her naughty employees are up to, but not before her own encounter with the strangely familiar Satine Phoenix. 5 1 2009-04-23 Mature Adult Noyounglesbianfemalenaughtystephaniemindcontinuesmalepopularbang http://www.iphods.com/movie/130/the-milf-next-door-4/ http://www.iphods.com/videos/0cda5377cd6d70f527792c5fa46d1460.m4v http://www.iphods.com/clips/thumbs/0cda5377cd6d70f527792c5fa46d1460.jpg The MILF Next Door 4 We've all fantasize about fucking those super hot older women that we see every day. At the grocery store, the gym, on the road or in their Mercedes, they're everywhere! Those fantasies become a crotch-throbbing reality right here! The hottest, slightly seasoned women in porn offer their mature muffs and older orifices for a good ol' fashioned fucking! They might be middle-aged but they fuck and suck like giddy young whores! 2 1 2009-04-23 Mature Adult Nowomensuckwhorescrotchfantasiesolder http://www.iphods.com/movie/131/she-had-it-cumming-2/ http://www.iphods.com/videos/cbe090f7d25271ef56d3e0d8fb5462df.m4v http://www.iphods.com/clips/thumbs/cbe090f7d25271ef56d3e0d8fb5462df.jpg She Had It Cumming 2 With an all-star cast of cock-loving teases, SHE HAD IT CUMMING 2 will have your cock like a rock. These dick-loving debutantes won't stop til you pop! They go through their entire bag of tricks, spreading wide for welcoming dicks! It's a XXX party with butt stuffed bitches, face fucking and D.P. drilling. Join in on the festivities! 3 1 2009-04-23 Mature Adult Nocockpartyyour cockbuttjoinbitchesfestdicksspreadstuffed http://www.iphods.com/movie/131/she-had-it-cumming-2/ http://www.iphods.com/videos/ee3d5f7a1aee479f3cbeb87b791b4288.m4v http://www.iphods.com/clips/thumbs/ee3d5f7a1aee479f3cbeb87b791b4288.jpg She Had It Cumming 2 With an all-star cast of cock-loving teases, SHE HAD IT CUMMING 2 will have your cock like a rock. These dick-loving debutantes won't stop til you pop! They go through their entire bag of tricks, spreading wide for welcoming dicks! It's a XXX party with butt stuffed bitches, face fucking and D.P. drilling. Join in on the festivities! 4 1 2009-04-23 Mature Adult Nocockpartyyour cockbuttjoinbitchesfestdicksspreadstuffed http://www.iphods.com/movie/137/girls-made-to-love/ http://www.iphods.com/videos/91507806653c2421a5be12ec602d3cd3.m4v http://www.iphods.com/clips/thumbs/91507806653c2421a5be12ec602d3cd3.jpg Girls Made To Love Real girls, real sex and real orgasms... it's all real, including the obvious attraction and sexual desire between abbywinter.com newcomer Cassie, and her hot Australian girlfriends Kiki and Keilyn. In her first ever girl girl video, Cassie is treated to an electrifying sex session with the salacious Keilyn in a steamy bathroom. Both girls are crazy for each other, eagerly experimenting with different positions and techniques to get each other off. Finishing with some erotic tribbing in the bath tub, their loud vocal orgasms and moans of pleasure say it all. Once their arguing stops and the loving begins, Cassie and Kiki are full of passion and vigor as they make love in their backyard. Cassie's moans of pleasure and her ever increasing quivers culminating in a kinky spray of girl-cum means Kiki knows exactly which buttons to push! 4.5 1 2009-04-17 Mature Adult Nolovepleasurevideoorgasmorgasmskinkyfriendsbutteroticgirl girlsteamyeagerpositionskeilynendsgirlfriendposition http://www.iphods.com/movie/139/busty-beauties-mammary-lane/ http://www.iphods.com/videos/20dc43ee464ff178c55d51b401ea8b1d.m4v http://www.iphods.com/clips/thumbs/20dc43ee464ff178c55d51b401ea8b1d.jpg Busty Beauties - Mammary Lane Take a walk down Mammary Lane with some of the biggest, juiciest juggs in the business. If they can jiggle it once, they can jiggle it again! Gianna goes gaga for a hard, stiff dick. Sara gets wet at the lick of a tit. Alexis does titty fucking right, while Whitney takes tit jiggling to a "hole" new level. And Puma's big knockers get drenched in cum! 3 1 2009-04-17 Mature Adult Nofuckingdickdoesbusinessbiggest http://www.iphods.com/movie/145/total-bi-urges-sex/ http://www.iphods.com/videos/19faf69d984e274faf4da1be679e0c95.m4v http://www.iphods.com/clips/thumbs/19faf69d984e274faf4da1be679e0c95.jpg Total Bi Urges Sex Total Bi urges Sex. Four hours of endless three-ways!!! Wet pussies, tight asses, group sex! Pussy pounding, cock sucking, and ass fucking! Either way, straight and gay, for an endless variety of insertions. Scene after scene is packed with hot bisexual hardcore action. Everyone wants a piece of everyone. All that you need in one DVD!! 4 1 2009-04-17 Mature Adult Notightfuckingsuckinghardcorepussiesfourthreepoundinggroupbisexualassestight ass http://www.iphods.com/movie/148/transsexual-babysitters-6/ http://www.iphods.com/videos/943df116feaa520c1c9f33eef2ffb979.m4v http://www.iphods.com/clips/thumbs/943df116feaa520c1c9f33eef2ffb979.jpg Transsexual Babysitters 6 So the new babysitter shows up and she's gorgeous! Suddenly your dinner date can wait; you gotta check this chick out instead. Buddy, are you in for a BIG surprise! This is no chick - she's a hot, horny and insatiable tranny! And she wants you as much as you want her! So pull out your stiff dick while she grabs hers. Here CUMs a nasty night on the wild side! Who knows, maybe she's better than a chick! 3.5 1 2009-04-09 Mature Adult Nonastydickhornywildnightsurpriseinsatiablecumschicktranny http://www.iphods.com/movie/150/miss-phat-booty-4/ http://www.iphods.com/videos/a412269b89394bb86c0a303613044f66.m4v http://www.iphods.com/clips/thumbs/a412269b89394bb86c0a303613044f66.jpg Miss Phat Booty 4 Watch raunchy Roxy Reynolds in a hot fuck fest with J. Depth while big booty Beauty gives Cuntree a nice city treat! Also, Deep Threat gets an extra juicy treat while Shorty Mac may have met his Destiny with a nice phat booty and heavenly body Ayana Angel catches hell J. Depth. Enjoy the view of Miss Phat Booty! 5 1 2009-04-09 Mature Adult Nobodynicehellshortangelbootyextrajuicyfestcuntview http://www.iphods.com/movie/155/crash-pad-series-episode-10-vais-solo/ http://www.iphods.com/videos/d79b8b638a4b4ae6af654a71ef13c673.m4v http://www.iphods.com/clips/thumbs/d79b8b638a4b4ae6af654a71ef13c673.jpg Crash Pad Series - Episode 10: Vai's Solo Vai seeks some solo time at the Crash Pad, but her imagination just might not leave her alone. Well of all the purposes I envisioned the Crash Pad to serve, I never thought of it as a study room. I imagine it takes a lot of focus to study in a place like this, and it would appear that Vai is a bit distracted. It's good to see that the apple does not fall far from the tree and the key is not far from the family. Perhaps she needs something to motivate her more? -Key Master 5 1 2009-04-03 Mature Adult Nomasteralone http://www.iphods.com/movie/161/the-darling-diaries/ http://www.iphods.com/videos/56f706d0b9249cbe87f9c8bc52bb6766.m4v http://www.iphods.com/clips/thumbs/56f706d0b9249cbe87f9c8bc52bb6766.jpg The Darling Diaries Again, we've gotten email after email, requesting some of the most outstanding scenes we have with Darling, and finally, we've answered your prayers! Loads of our most classic Darling footage is included here on this release "The Darling Diaries." Classic flogging and whipping from "Deconstructing Darling," to hardcore spanking first seen in "Spanks for The Memories," to inverted suspension and pussy torture from "The Bondage Chronicles 1" and "Lessons In Obedience." Watch as she squirms and strains under the attentions of Warlock's whip and cane, the marks of abject submission glowing red as she is taught to surrender every inch of herself to the pleasure completely. It's all here in one film for you to enjoy, and don't worry, there's plenty more Darling coming your way! 3 1 2009-04-03 Mature Adult Nobondagepleasurefinallyfilmveryhardcorefoottorturespanksfootagewhippingwhipclassicreleasesubmissioncompletelylessoncomplete http://www.iphods.com/movie/161/the-darling-diaries/ http://www.iphods.com/videos/89518769fb8c3ceb003349d13ee01a96.m4v http://www.iphods.com/clips/thumbs/89518769fb8c3ceb003349d13ee01a96.jpg The Darling Diaries Again, we've gotten email after email, requesting some of the most outstanding scenes we have with Darling, and finally, we've answered your prayers! Loads of our most classic Darling footage is included here on this release "The Darling Diaries." Classic flogging and whipping from "Deconstructing Darling," to hardcore spanking first seen in "Spanks for The Memories," to inverted suspension and pussy torture from "The Bondage Chronicles 1" and "Lessons In Obedience." Watch as she squirms and strains under the attentions of Warlock's whip and cane, the marks of abject submission glowing red as she is taught to surrender every inch of herself to the pleasure completely. It's all here in one film for you to enjoy, and don't worry, there's plenty more Darling coming your way! 2 1 2009-04-03 Mature Adult Nobondagepleasurefinallyfilmveryhardcorefoottorturespanksfootagewhippingwhipclassicreleasesubmissioncompletelylessoncomplete http://www.iphods.com/movie/169/wish-to-be-hentai/ http://www.iphods.com/videos/8f54861d3d8c62180053b3230ca90679.m4v http://www.iphods.com/clips/thumbs/8f54861d3d8c62180053b3230ca90679.jpg Wish To Be Hentai This Japanese live action release is more fun than a barrel full of Hentai. In the first scene alone there's latex, urination, Riri creates some art with a very special part of her body, and flowers are planted in her flower! It only gets better from there in this crazy Asian import, so don't miss this amazing release from our friends at Crystal! 3.5 1 2009-03-26 Mature Adult Nobodyveryfriendsasianalonereleasejapaneseflowerlatexends http://www.iphods.com/movie/169/wish-to-be-hentai/ http://www.iphods.com/videos/687c7751615e1d886be947910631cb50.m4v http://www.iphods.com/clips/thumbs/687c7751615e1d886be947910631cb50.jpg Wish To Be Hentai This Japanese live action release is more fun than a barrel full of Hentai. In the first scene alone there's latex, urination, Riri creates some art with a very special part of her body, and flowers are planted in her flower! It only gets better from there in this crazy Asian import, so don't miss this amazing release from our friends at Crystal! 3 1 2009-03-26 Mature Adult Nobodyveryfriendsasianalonereleasejapaneseflowerlatexends http://www.iphods.com/movie/169/wish-to-be-hentai/ http://www.iphods.com/videos/6729d1a116a07e95189bc283fc625a0e.m4v http://www.iphods.com/clips/thumbs/6729d1a116a07e95189bc283fc625a0e.jpg Wish To Be Hentai This Japanese live action release is more fun than a barrel full of Hentai. In the first scene alone there's latex, urination, Riri creates some art with a very special part of her body, and flowers are planted in her flower! It only gets better from there in this crazy Asian import, so don't miss this amazing release from our friends at Crystal! 4 1 2009-03-26 Mature Adult Nobodyveryfriendsasianalonereleasejapaneseflowerlatexends http://www.iphods.com/movie/170/kingdom-of-facesitting/ http://www.iphods.com/videos/c3cdb1d003a2fc00b0b789ba9c8b09e9.m4v http://www.iphods.com/clips/thumbs/c3cdb1d003a2fc00b0b789ba9c8b09e9.jpg Kingdom Of Facesitting Welcome to the kingdom of your dreams. Two mistresses. Both blondes. Both gorgeous. Both craving your tongue in their asses! Part One - Mistress Ashley Fires shows off her tight body, her black fishnet stockings, and hot crotch in POV. Her pale, lustrous skin glows as she opens her holes just for you. Enter Slave Freddy. Shackled to the bed, Mistress Ashley stands over him, beating him with his own leash. Right away you know this mistress knows how to take charge. Her orders are clear and if her slave makes a mistake he's going to pay the price. In the beginning, her pussy is off limits. When she sits over his face, Freddy must first breathe in the fragrance of her ass. Then kiss her cheeks, then lick her crack. He clearly yearns to taste her asshole, but she torments him by keeping it out of reach. She lets him lick circles around her anus. When his tongue meets her butthole, she punishes him. She drops her full weight on his face, denying him air. She tortures him this way repeatedly before finally allowi 5 1 2009-03-26 Mature Adult Nopussylovetightslavebodymistressnicedeepfinallywildevenblackorgasmblondetonguebuttkissholesloveslickingcrotchfingerashleyeagercravingfacesittingcreamskinhappyassholeasses,faces,mistresses,fingers,stockings,spread,helpless,works,close,clit http://www.iphods.com/movie/180/edwina-4-back-for-more/ http://www.iphods.com/videos/4b188cd8a09b81383e726bf8b4b19a5c.m4v http://www.iphods.com/clips/thumbs/4b188cd8a09b81383e726bf8b4b19a5c.jpg Edwina 4 - Back For More Edwina is back for more. Irene Boss, Lady Tantalize, and Mistress V. are more than happy to help. Watch as Edwina is cross dressed and trained in a domestic setting. Strap on, emasculation, humiliation, maid training, shoe, foot worship, spanking, caning, tp humiliation, whipping, serving, ect. If you liked "Gang Bang", "The Victim", and "Edwina Returns" then this is for you! 3 1 2009-03-20 Mature Adult Nospankingmistresscaningtrainingwhippingwhipladyhappyirenebossbanghumiliation http://www.iphods.com/movie/184/bi-maxx-volume-20/ http://www.iphods.com/videos/414f7cb87e86fd77b0ca6432bf8ebb70.m4v http://www.iphods.com/clips/thumbs/414f7cb87e86fd77b0ca6432bf8ebb70.jpg Bi Maxx Volume 20 Prepare for some of the hottest anything goes MMF action ever caught on film. BiMaxxx volume twenty includes five incredibly hot threesomes, perfect for guys and girls who love both cock and cunt. Along with the regular, amazing MMF action, this volume includes some nasty anal action, rimming, and a whole lot of gooey cum being shot on both guy and girl! 3.5 1 2009-03-20 Mature Adult Nonastyhottestguysanalanythingthreeincludescaughtcuntregular http://www.iphods.com/movie/184/bi-maxx-volume-20/ http://www.iphods.com/videos/1b40fb0d95699457d43adc280b0296e5.m4v http://www.iphods.com/clips/thumbs/1b40fb0d95699457d43adc280b0296e5.jpg Bi Maxx Volume 20 Prepare for some of the hottest anything goes MMF action ever caught on film. BiMaxxx volume twenty includes five incredibly hot threesomes, perfect for guys and girls who love both cock and cunt. Along with the regular, amazing MMF action, this volume includes some nasty anal action, rimming, and a whole lot of gooey cum being shot on both guy and girl! 4.5 1 2009-03-20 Mature Adult Nonastyhottestguysanalanythingthreeincludescaughtcuntregular http://www.iphods.com/movie/186/hurtin-for-a-squirtin-3/ http://www.iphods.com/videos/285d802d5a8bd8ae4fd467a5aa0935a2.m4v http://www.iphods.com/clips/thumbs/285d802d5a8bd8ae4fd467a5aa0935a2.jpg Hurtin' For A Squirtin' 3 If you lover squatter's, than this if for you! Maxine X and her hot horny friends are here to make you hard. Watch how they squirt up a storm and enjoy the pussy juice they worked so hard to extract. Nothing is hotter than this and I am sure you will agree! This is true squirting that you crave and it's one hot site. 2.5 1 2009-03-13 Mature Adult Nolovehornyhot hornyextrahottersquirtingsquirtends http://www.iphods.com/movie/186/hurtin-for-a-squirtin-3/ http://www.iphods.com/videos/a573babfb174979b0c4031898a55f7df.m4v http://www.iphods.com/clips/thumbs/a573babfb174979b0c4031898a55f7df.jpg Hurtin' For A Squirtin' 3 If you lover squatter's, than this if for you! Maxine X and her hot horny friends are here to make you hard. Watch how they squirt up a storm and enjoy the pussy juice they worked so hard to extract. Nothing is hotter than this and I am sure you will agree! This is true squirting that you crave and it's one hot site. 2.5 1 2009-03-13 Mature Adult Nolovehornyhot hornyextrahottersquirtingsquirtends http://www.iphods.com/movie/187/girls-desired/ http://www.iphods.com/videos/4313f737aba384dad1275e27c667061f.m4v http://www.iphods.com/clips/thumbs/4313f737aba384dad1275e27c667061f.jpg Girls Desired Cleo, Keilyn, and Larissa are the ultimate Australian hotties who love sex. Raunchy red-head Larissa and kinky Keilyn have never met. Witness the moment they lay eyes on each other for the very first time, and see their initial surprise quickly fade as their carnal instincts awaken. They start passionately kissing and exploring every curve of each other's bodies, exploring with orgasm after orgasm, and they don't even know each other's name! Larissa and Cleo start their liaison at the local cafe. The attraction is electric and they decide to continue their rendezvous at home when things really heat up. Larissa and Cleo lick, suck, and fuck with energy and enthusiasm like you've never seen. The sex is so hot, they even introduce some kinky ice cube play to cool things off, but it actually just heats it up even MORE! 3 1 2009-03-13 Mature Adult Nosuckevenorgasmkissingkinkykisseyessurprisehottieslarissakeilynfirst timepassionateultimatedecide http://www.iphods.com/movie/187/girls-desired/ http://www.iphods.com/videos/25d1c30424b968d247d11670eacdd139.m4v http://www.iphods.com/clips/thumbs/25d1c30424b968d247d11670eacdd139.jpg Girls Desired Cleo, Keilyn, and Larissa are the ultimate Australian hotties who love sex. Raunchy red-head Larissa and kinky Keilyn have never met. Witness the moment they lay eyes on each other for the very first time, and see their initial surprise quickly fade as their carnal instincts awaken. They start passionately kissing and exploring every curve of each other's bodies, exploring with orgasm after orgasm, and they don't even know each other's name! Larissa and Cleo start their liaison at the local cafe. The attraction is electric and they decide to continue their rendezvous at home when things really heat up. Larissa and Cleo lick, suck, and fuck with energy and enthusiasm like you've never seen. The sex is so hot, they even introduce some kinky ice cube play to cool things off, but it actually just heats it up even MORE! 4 1 2009-03-13 Mature Adult Nosuckevenorgasmkissingkinkykisseyessurprisehottieslarissakeilynfirst timepassionateultimatedecide http://www.iphods.com/movie/187/girls-desired/ http://www.iphods.com/videos/42529209d576b54938146c1637c3d96f.m4v http://www.iphods.com/clips/thumbs/42529209d576b54938146c1637c3d96f.jpg Girls Desired Cleo, Keilyn, and Larissa are the ultimate Australian hotties who love sex. Raunchy red-head Larissa and kinky Keilyn have never met. Witness the moment they lay eyes on each other for the very first time, and see their initial surprise quickly fade as their carnal instincts awaken. They start passionately kissing and exploring every curve of each other's bodies, exploring with orgasm after orgasm, and they don't even know each other's name! Larissa and Cleo start their liaison at the local cafe. The attraction is electric and they decide to continue their rendezvous at home when things really heat up. Larissa and Cleo lick, suck, and fuck with energy and enthusiasm like you've never seen. The sex is so hot, they even introduce some kinky ice cube play to cool things off, but it actually just heats it up even MORE! 2 1 2009-03-13 Mature Adult Nosuckevenorgasmkissingkinkykisseyessurprisehottieslarissakeilynfirst timepassionateultimatedecide http://www.iphods.com/movie/192/girls-gone-wrong/ http://www.iphods.com/videos/e8545716b9251cad98084c9e03ff8e9a.m4v http://www.iphods.com/clips/thumbs/e8545716b9251cad98084c9e03ff8e9a.jpg Girls Gone Wrong These girls know that if they want to stay in Master Seven's good graces they need to do what they are told. That includes tying up, spanking, pinching, and any other means of punishment to all the girls who might fall out of line. For the most part all goes well until we have...GIRLS GONE WRONG! Cum and see for yourself what these lusty babes are all about! 5 1 2009-03-13 Mature Adult Nospankingpunishmentmasterevenincludes http://www.iphods.com/movie/192/girls-gone-wrong/ http://www.iphods.com/videos/f53ae1f08c9dc135083c806714827a9a.m4v http://www.iphods.com/clips/thumbs/f53ae1f08c9dc135083c806714827a9a.jpg Girls Gone Wrong These girls know that if they want to stay in Master Seven's good graces they need to do what they are told. That includes tying up, spanking, pinching, and any other means of punishment to all the girls who might fall out of line. For the most part all goes well until we have...GIRLS GONE WRONG! Cum and see for yourself what these lusty babes are all about! 3.5 1 2009-03-13 Mature Adult Nospankingpunishmentmasterevenincludes http://www.iphods.com/movie/192/girls-gone-wrong/ http://www.iphods.com/videos/e9f1f9da3e734209f2b69664a6b221e9.m4v http://www.iphods.com/clips/thumbs/e9f1f9da3e734209f2b69664a6b221e9.jpg Girls Gone Wrong These girls know that if they want to stay in Master Seven's good graces they need to do what they are told. That includes tying up, spanking, pinching, and any other means of punishment to all the girls who might fall out of line. For the most part all goes well until we have...GIRLS GONE WRONG! Cum and see for yourself what these lusty babes are all about! 5 1 2009-03-13 Mature Adult Nospankingpunishmentmasterevenincludes http://www.iphods.com/movie/197/hot-teen-ass/ http://www.iphods.com/videos/7666f67386d46658f5d5347576e96531.m4v http://www.iphods.com/clips/thumbs/7666f67386d46658f5d5347576e96531.jpg Hot Teen Ass Whip out your cock and get ready to play with these hot tight teen vixens. Don't be fooled by their age, because these very naughty and experienced sluts love to suck, fuck and moan until their tight little throats are filled with cum! We've got five girls who are just 18, but prove that they know their way around a cock in this hardcore flick. Don't miss this teen fuck fest, your dick would never forgive you! 4 1 2009-03-05 Mature Adult Nolovetightexperienceverysuckhardcoreslutyour cockfillednaughtywhipexperiencedfest http://www.iphods.com/movie/200/teacher-taught/ http://www.iphods.com/videos/8717a9e7898eec3ab9d3e985d6afe825.m4v http://www.iphods.com/clips/thumbs/8717a9e7898eec3ab9d3e985d6afe825.jpg Teacher Taught Teacher Tiki comes to the home of one of her students to admonish the parent for the poor performance of the student in class... and gets a lesson in discipline of her own. Snatching, stripping, strapping, slapping, bit gagging, deep throating, anal rodding, butt plugging, crotch rope action! Get this one! Check out scenes from up and coming films from this studio. Bonus Footage 4.5 1 2009-03-05 Mature Adult Nofootbuttfootageropecrotchpoorbonusfilmslessonteacher http://www.iphods.com/movie/201/rick-savage-presents-bbw-bondage/ http://www.iphods.com/videos/ded102044d5066676b979acb7349401d.m4v http://www.iphods.com/clips/thumbs/ded102044d5066676b979acb7349401d.jpg Rick Savage Presents BBW Bondage Pretty BBW Christy is surprised to find Master Rick at her local SandM toy and clothing store, and Rick is about to make Christy's dream of making an SandM movie come true. First, right in the store, he tests her submissive nature by commanding her to remove her blouse, expose and squeeze her boobs very hard. She obeys. Satisfied with her affinity for submission, Rick takes his excited big beautiful woman to a nearby, fully equipped dungeon for an afternoon of BandD pleasure. First Rick uses his bare hands for a session of tit torture and tit spanking. Next, the Master puts our submissive BBW in restraint and tit-whips and flogs her. Wicked nipple clamps are applied to her nipples and heavy weights are attached to the clamps. Christy is next put into stocks for an utterly amazing session of ass punishment that begins with bare handed spanking, graduates to a wooden cutting board paddling and finishes with Master Rick spanking Christy's red ass cheeks with a cricket bat. A REAL cricket bat. Finally 3 1 2009-03-05 Mature Adult Nospankingtitsbondagepunishmenthandsbodypleasuremasterfinallywomanveryprettytorturesubmissiveropenipplessurprisebarewhipheavysubmissionjapanesedungeonboobsnipple http://www.iphods.com/movie/201/rick-savage-presents-bbw-bondage/ http://www.iphods.com/videos/06310ddb4711b85d19260d3ec0daaa11.m4v http://www.iphods.com/clips/thumbs/06310ddb4711b85d19260d3ec0daaa11.jpg Rick Savage Presents BBW Bondage Pretty BBW Christy is surprised to find Master Rick at her local SandM toy and clothing store, and Rick is about to make Christy's dream of making an SandM movie come true. First, right in the store, he tests her submissive nature by commanding her to remove her blouse, expose and squeeze her boobs very hard. She obeys. Satisfied with her affinity for submission, Rick takes his excited big beautiful woman to a nearby, fully equipped dungeon for an afternoon of BandD pleasure. First Rick uses his bare hands for a session of tit torture and tit spanking. Next, the Master puts our submissive BBW in restraint and tit-whips and flogs her. Wicked nipple clamps are applied to her nipples and heavy weights are attached to the clamps. Christy is next put into stocks for an utterly amazing session of ass punishment that begins with bare handed spanking, graduates to a wooden cutting board paddling and finishes with Master Rick spanking Christy's red ass cheeks with a cricket bat. A REAL cricket bat. Finally 2 1 2009-03-05 Mature Adult Nospankingtitsbondagepunishmenthandsbodypleasuremasterfinallywomanveryprettytorturesubmissiveropenipplessurprisebarewhipheavysubmissionjapanesedungeonboobsnipple http://www.iphods.com/movie/220/real-girls-real-sex/ http://www.iphods.com/videos/4ab91bef500c49bbfb33c175029bd5d3.m4v http://www.iphods.com/clips/thumbs/4ab91bef500c49bbfb33c175029bd5d3.jpg Real Girls Real Sex "Real Girls Real Sex" stars big breasted Blaire initiating first-timers Keilyn and Larissa in two passionate girl-girl scenes. Blaire and Keilyn are tender and sensual to start but both quickly get very horny. These girls aren't shy to experiment. With lots of licking, sucking, fingering, and rimming in numerous positions with multiple electrifying orgasms, Blaire and Keilyn are a perfect match! The cameras aren't even ready when Blaire and Larissa start passionately kissing on the wooden floor. They soon move to the bedroom where Blaire takes charge of their steamy sex sessions. She directs Larissa to pleasure her exactly how and where she likes it. Both girls are full of energy as they erupt with several pulsating orgasms. Can't get enough of Blaire? Check out her bonus masturbation video with the mesmerizing Marigold. Watch their tits bounce in unison, listen to them dirty talk and then look out for their perfectly timed orgasms! 4 1 2009-02-17 Mature Adult Nogirltitssuckinghornypleasurevideosuckorgasmorgasmskissingcameradirtykisslickingfingersteamypositionslarissabedroomblairekeilynmasturbationpassionatebonuspositionfloor http://www.iphods.com/movie/224/disciplining-betty/ http://www.iphods.com/videos/b9491868c9302301a21b55b70e221e8b.m4v http://www.iphods.com/clips/thumbs/b9491868c9302301a21b55b70e221e8b.jpg Disciplining Betty Razor wants Betty to get better grades in college, but she can't seem to focus on that. She agrees to submit to discipline to help her concentrate, before realizing exactly what that means to her boyfriend. Familiar with "fun and games" style spanking, the feel of a hard and disciplinary hand on her silky smooth bottom comes as something of a shock! Razor spanks Betty hard and scolds her roundly. But Betty is a modern girl who resents such condescending treatment and doesn't scruple to let him know this. (Since this is a spanking video, her protests are ignored. Don't try this at home - unless you're dating a fellow spanking enthusiast!) After a not very gentle warm up, Betty's classic straight skirt is lifted and she treated to a brisk panty warming, during which the disciplinarian boyfriend barely pauses to notice the elegance of her silk lingerie combination. In due course, the voluptuous coed is stripped down to her dainty matching bra and panty, heels and hose ensemble, to receive the full measure of 3 1 2009-02-17 Mature Adult Nospankingyoungpunishmenthandspartybodywomanfilmvideoevendoesfetishlifeboyfriendspankedbottomfriendsspanksbrunettestylehighnaturalalwaysbarelearnhairpaddlegamesoralolderlady,classic,razor,lingerie,heels,breasts,lover,feature,ends,girlfriend,complete,queen,position,voluptuous,stripped,videos,free http://www.iphods.com/movie/224/disciplining-betty/ http://www.iphods.com/videos/fbef70576d2b639e28ba3d36651fa18c.m4v http://www.iphods.com/clips/thumbs/fbef70576d2b639e28ba3d36651fa18c.jpg Disciplining Betty Razor wants Betty to get better grades in college, but she can't seem to focus on that. She agrees to submit to discipline to help her concentrate, before realizing exactly what that means to her boyfriend. Familiar with "fun and games" style spanking, the feel of a hard and disciplinary hand on her silky smooth bottom comes as something of a shock! Razor spanks Betty hard and scolds her roundly. But Betty is a modern girl who resents such condescending treatment and doesn't scruple to let him know this. (Since this is a spanking video, her protests are ignored. Don't try this at home - unless you're dating a fellow spanking enthusiast!) After a not very gentle warm up, Betty's classic straight skirt is lifted and she treated to a brisk panty warming, during which the disciplinarian boyfriend barely pauses to notice the elegance of her silk lingerie combination. In due course, the voluptuous coed is stripped down to her dainty matching bra and panty, heels and hose ensemble, to receive the full measure of 3.5 1 2009-02-17 Mature Adult Nospankingyoungpunishmenthandspartybodywomanfilmvideoevendoesfetishlifeboyfriendspankedbottomfriendsspanksbrunettestylehighnaturalalwaysbarelearnhairpaddlegamesoralolderlady,classic,razor,lingerie,heels,breasts,lover,feature,ends,girlfriend,complete,queen,position,voluptuous,stripped,videos,free http://www.iphods.com/movie/248/teachers-pet-3/ http://www.iphods.com/videos/e6ef069b93cfd1e366ec6e46da29ab1c.m4v http://www.iphods.com/clips/thumbs/e6ef069b93cfd1e366ec6e46da29ab1c.jpg Teachers Pet 3 French teacher, Anastasia knows how to captivate the attention of her new student Christina Carter. The restrained and gagged au pair is made to learn quickly and fulfill all her teacher's Desires. Bound struggles, gagged with lemons, forced orgasm, wicked games and dick on a stick are all part of the learning process! That will teach her to question her teacher's authority! 2.5 1 2009-01-29 Mature Adult Noboundforcedorgasmgaggedlearngamesteacherpair http://www.iphods.com/movie/256/barefoot-and-pregnant-25/ http://www.iphods.com/videos/35898c53620b79baaa353fa47c2ee7fa.m4v http://www.iphods.com/clips/thumbs/35898c53620b79baaa353fa47c2ee7fa.jpg Barefoot And Pregnant 25 When you see a hot preggos walking down the street, one thing should be incredibly obvious. She definitely fucks! These pregnant ladies don't have the normal pregnancy cravings. They're not bitching for no good reason at all, and they're not asking for mashed potatoes and fucking catsup. Instead they beg for cock and lots of it. Timea isn't about to let her huge belly stop her from getting her hole filled. Eszter may look like she's ready to pop, but she still fucks and sucks like a pro. Watch Nikoletta's milk sacks bounce as she rides that stiff cock. 2.5 1 2009-01-23 Mature Adult Nofuckingladiessuckfilledridehugefuckstoescravingskin http://www.iphods.com/movie/264/revenge-of-the-milfs/ http://www.iphods.com/videos/8219046872bb4bd02ae10c0265130329.m4v http://www.iphods.com/clips/thumbs/8219046872bb4bd02ae10c0265130329.jpg Revenge Of The MILFS These MILFs are sick of their husbands' bullshit and they are seeking revenge of the naughtiest kind! Hustler brings you only the hottest, most fuckable moms in the industry and they are about to turn some unsuspecting boy toys into men. They are tired of not getting their needs met by their mates so they suck and fuck until justice is served. Heidi Mayne takes an anal reaming that her hubby is sure to regret missing. Do you like the voluptuously delicious mamas? Well Friday is just that, and her hungry shaved pussy gets used by a nice thick black cock. Get ready for the taste of sweet revenge covered in MILF juice! 4.5 1 2009-01-15 Mature Adult Nohottestniceanalblackthicktoysshavedusedcoveredhusbandmomsmilfmilfsunsuspectingrevengevoluptuous http://www.iphods.com/movie/265/shemale-models/ http://www.iphods.com/videos/fbebb94a90234d987dd69e6a4fe7ca28.m4v http://www.iphods.com/clips/thumbs/fbebb94a90234d987dd69e6a4fe7ca28.jpg SheMale Models These shemales are on a mission to get their brains fucked out and look good while getting their backs banged out. Four scenes of hot tranny action will have you rock hard. With blowjobs that'll make any woman envious and any guy drool and intense shemale ass fucking, these trannies will have your cock twitching like it has a mind of it's own! What more could you ask for? 5 1 2009-01-15 Mature Adult Nofuckingwomanfouryour cockintenseblowjobsmindblowrock hardshemalesmalebangtranny http://www.iphods.com/movie/265/shemale-models/ http://www.iphods.com/videos/fe80787bb84d1825d56f5991e086865a.m4v http://www.iphods.com/clips/thumbs/fe80787bb84d1825d56f5991e086865a.jpg SheMale Models These shemales are on a mission to get their brains fucked out and look good while getting their backs banged out. Four scenes of hot tranny action will have you rock hard. With blowjobs that'll make any woman envious and any guy drool and intense shemale ass fucking, these trannies will have your cock twitching like it has a mind of it's own! What more could you ask for? 4 1 2009-01-15 Mature Adult Nofuckingwomanfouryour cockintenseblowjobsmindblowrock hardshemalesmalebangtranny http://www.iphods.com/movie/267/woman-vs-machine/ http://www.iphods.com/videos/b061e0fb62075919086dd8b8bb26723c.m4v http://www.iphods.com/clips/thumbs/b061e0fb62075919086dd8b8bb26723c.jpg Woman Vs Machine Two girls plus one machine = One good fucking time! In Woman Vs Machine, the petite cutie Ashley Bands and buxom Kalissa Fellatio test their erotic abilities on a fucking machine! They are bound first and then strapped to this electronic joy to seek the ride of their lives! These black girls will be pleasure like never before proving that technology can really only improve our lives. 4 1 2009-01-15 Mature Adult Nogirlsboundwomanblackrideeroticashleytwo girls http://www.iphods.com/movie/267/woman-vs-machine/ http://www.iphods.com/videos/781d75405346f240c10b9a7e06bdefb2.m4v http://www.iphods.com/clips/thumbs/781d75405346f240c10b9a7e06bdefb2.jpg Woman Vs Machine Two girls plus one machine = One good fucking time! In Woman Vs Machine, the petite cutie Ashley Bands and buxom Kalissa Fellatio test their erotic abilities on a fucking machine! They are bound first and then strapped to this electronic joy to seek the ride of their lives! These black girls will be pleasure like never before proving that technology can really only improve our lives. 4.5 1 2009-01-15 Mature Adult Nogirlsboundwomanblackrideeroticashleytwo girls http://www.iphods.com/movie/267/woman-vs-machine/ http://www.iphods.com/videos/cf115d609a6d5ef1ac09d2ab6fa76fe4.m4v http://www.iphods.com/clips/thumbs/cf115d609a6d5ef1ac09d2ab6fa76fe4.jpg Woman Vs Machine Two girls plus one machine = One good fucking time! In Woman Vs Machine, the petite cutie Ashley Bands and buxom Kalissa Fellatio test their erotic abilities on a fucking machine! They are bound first and then strapped to this electronic joy to seek the ride of their lives! These black girls will be pleasure like never before proving that technology can really only improve our lives. 2 1 2009-01-15 Mature Adult Nogirlsboundwomanblackrideeroticashleytwo girls http://www.iphods.com/movie/269/training-kapri/ http://www.iphods.com/videos/11f998d04f8a2ba667bce08a62d3dc1f.m4v http://www.iphods.com/clips/thumbs/11f998d04f8a2ba667bce08a62d3dc1f.jpg Training Kapri Kapri Styles is your everyday run of the mill Hollywood porn star that lacks discipline. She was sent by her boyfriend to Master D to be trained and disciplined the right way. Master D put a dog collar around her neck and leads her into his training office and teaches her a lesson she will never forget. He whip sand tickles her before tying her up only to whip her some more. After tying her up Master D fucks her with a 14 inch dildo forcing her to cum. Then he blindfolds her and spanks her big firm ass. Next he hog ties her and lays her across his lap for a good old I'm your daddy ass whipping. Then he brings out his favorite training tool, a low voltage stun gun for some shock punishment. Last he places cloth pens on her clit, pussy lips and nipples as he forces her to masturbate and dildo fuck herself before making her kiss his feet. 4.5 1 2009-01-15 Mature Adult Nopussypunishmentmasterverypornfeetboyfriendkissdildospanksstylefuckstrainingticklenippleswhippingofficewhipfavoritelipslessonnippleclithollywood http://www.iphods.com/movie/279/grazis-anal-crazy/ http://www.iphods.com/videos/87b381a5d5d8687a92f408f16a81e814.m4v http://www.iphods.com/clips/thumbs/87b381a5d5d8687a92f408f16a81e814.jpg Grazi's Anal Crazy Grazi Fantini is horny as ever and she wants to get fucked with a stiff hard cock up her tight waiting ass! This skin flick is strictly for hardcore ass enthusiasts! Watch as this dirty slut begs to have her ass stretched, leaving her with a very pleasurable anal gaper! Enjoy! 2.5 1 2009-01-08 Mature Adult Nocockhornyanalhardcoredirtyhard cockskin http://www.iphods.com/movie/281/yasmine-regina-pornochic-16-french/ http://www.iphods.com/videos/adf24acdb7b618fd52e68db212133a4a.m4v http://www.iphods.com/clips/thumbs/adf24acdb7b618fd52e68db212133a4a.jpg Yasmine and Regina Pornochic 16 (French) Raw Sex: In the rustic decor of a garage, a gorgeous blonde gives her charms to three men at the same time in a scorching threesome! The Voyeurs: Half-naked, two nymphets caress themselves watching a porn movie and get hot and sticky when they bring out their dildo and have a little lesbian anal play! Meeting Villa: A delightful hostess takes a lady to the man who is waiting for her before joining them for a hot threesome with some strap-on fun! The Scrap Yard: Among shells, two lovers taste the pleasures of fellatio and cunnilingus. The Contract: In an opulent-looking flat, a man is negotiating a contract with his visitor when his charming wife intervenes. This leads to a red-hot threesome with not only anal sex, but a double penetration! Castle Life: Masked with lace, a young lady gives her guests the treasures of her body. And their favorite treasure is hiding deep inside her ass! 3 1 2009-01-08 Mature Adult Noloveyounglesbianbodypleasuredoubleanalplayblondepornlifethreehelldildojoinwifefavoriteladyloverslovernakedpenetrationdeep inside http://www.iphods.com/movie/288/teen-anal-pounding-3/ http://www.iphods.com/videos/db3cc6e6c70394cfde6be2d411e32c46.m4v http://www.iphods.com/clips/thumbs/db3cc6e6c70394cfde6be2d411e32c46.jpg Teen Anal Pounding #3 Who doesn't like butt sex? Or more precisely, who doesn't like watching foxy teenage girls getting bamboozled into giving up their smooth young asses for a brutal pounding? Nobody, that's who! TEEN ANAL POUNDING abandons all subtlety in favor of unrepentant backdoor onslaught. You'll see these slutty teenagers take to anal like sluts to fucking! They'll even give you a blowjob before and after you pound their ass! Ahh, there's nothing like ATM! One little butt slut even has a threesome where she gets filled up with a double penetration! 3 1 2009-12-31 Mature Adult Noyoungfuckingbodydoubleevenanaldoesslutthreebuttpoundingfilleddoorblowassespenetration http://www.iphods.com/movie/288/teen-anal-pounding-3/ http://www.iphods.com/videos/275dfb89d9a37c0e194adc2725fb8c3c.m4v http://www.iphods.com/clips/thumbs/275dfb89d9a37c0e194adc2725fb8c3c.jpg Teen Anal Pounding #3 Who doesn't like butt sex? Or more precisely, who doesn't like watching foxy teenage girls getting bamboozled into giving up their smooth young asses for a brutal pounding? Nobody, that's who! TEEN ANAL POUNDING abandons all subtlety in favor of unrepentant backdoor onslaught. You'll see these slutty teenagers take to anal like sluts to fucking! They'll even give you a blowjob before and after you pound their ass! Ahh, there's nothing like ATM! One little butt slut even has a threesome where she gets filled up with a double penetration! 2.5 1 2009-12-31 Mature Adult Noyoungfuckingbodydoubleevenanaldoesslutthreebuttpoundingfilleddoorblowassespenetration http://www.iphods.com/movie/290/tickle-time/ http://www.iphods.com/videos/b5a8af0e7c71f865e4bff8854a983796.m4v http://www.iphods.com/clips/thumbs/b5a8af0e7c71f865e4bff8854a983796.jpg Tickle Time Hey all you tickle fetish fans out there: you'll love this film. You'll love it because someone is writhing with the joy of tickling - whether they like it or not. Five hilarious tickle torture sessions that will keep you entertained! Watch as these submissive ladies take on a severe tickle torture while being restrained. They can wiggle as much as they want, but they won't be able to escape the tickle torment! Are you ready to see them squirm? 4.5 1 2009-12-31 Mature Adult Noladiesfilmfetishtorturesubmissivetickleseverefanstickling http://www.iphods.com/movie/294/lesbian-tutors-8/ http://www.iphods.com/videos/38edaccd21dcfd52e8bf1e9d7ef77219.m4v http://www.iphods.com/clips/thumbs/38edaccd21dcfd52e8bf1e9d7ef77219.jpg Lesbian Tutors #8 Sunny gives Elexis a surprise birthday present that leaves her breathless. Annabelle is welcomed aboard at her new job by Misty, who shows her how to gain favor with the boss. When Private Deluna is AWOL on her very first leave, Sgt. Lay offers a possible solution to her dilemma. These naturally stunning lesbians are experts at cunnalingus, using strap-ons and scissoring. This movie will make you a rainbow lover within minutes! 5 1 2009-12-23 Mature Adult Nolovelesbianlesbiansnaturalsurpriseloverbossleaves http://www.iphods.com/movie/294/lesbian-tutors-8/ http://www.iphods.com/videos/fbc17a2999c50b51e8c0d9f829131b9a.m4v http://www.iphods.com/clips/thumbs/fbc17a2999c50b51e8c0d9f829131b9a.jpg Lesbian Tutors #8 Sunny gives Elexis a surprise birthday present that leaves her breathless. Annabelle is welcomed aboard at her new job by Misty, who shows her how to gain favor with the boss. When Private Deluna is AWOL on her very first leave, Sgt. Lay offers a possible solution to her dilemma. These naturally stunning lesbians are experts at cunnalingus, using strap-ons and scissoring. This movie will make you a rainbow lover within minutes! 5 1 2009-12-23 Mature Adult Nolovelesbianlesbiansnaturalsurpriseloverbossleaves http://www.iphods.com/movie/294/lesbian-tutors-8/ http://www.iphods.com/videos/49a05c840cf07c0366150761959c6661.m4v http://www.iphods.com/clips/thumbs/49a05c840cf07c0366150761959c6661.jpg Lesbian Tutors #8 Sunny gives Elexis a surprise birthday present that leaves her breathless. Annabelle is welcomed aboard at her new job by Misty, who shows her how to gain favor with the boss. When Private Deluna is AWOL on her very first leave, Sgt. Lay offers a possible solution to her dilemma. These naturally stunning lesbians are experts at cunnalingus, using strap-ons and scissoring. This movie will make you a rainbow lover within minutes! 2 1 2009-12-23 Mature Adult Nolovelesbianlesbiansnaturalsurpriseloverbossleaves http://www.iphods.com/movie/319/tag-team-strap-on/ http://www.iphods.com/videos/3acd4f483245e5eafa49016acad6b4e5.m4v http://www.iphods.com/clips/thumbs/3acd4f483245e5eafa49016acad6b4e5.jpg Tag-Team Strap-On One woman in the throes of a snarl is bad enough. Two teamed up on the rag, or whatever turns them evil, is all it takes for an unbridled afternoon of mayhem. As a result, mankind is doomed, sucking up to these banshees. Banks are closing, and other sacred institutions we hold neat and dear are crumbling. Forget what you've read as an excuse. It's because men are now taking it up the ass. In this hot strap-on film, real life couples welcome a domme into their relationship and the result is one pain in the ass for dear old hubby. These men are completely dominated, as two angry bitches with big rubber cocks violate their tender assholes. 2 1 2009-12-12 Mature Adult Nocockpainsuckingwomanfilmsuckcockslifeholesassholesbitchescouplesassholerubbercompletelycouplecomplete http://www.iphods.com/movie/330/lesbian-love-vol-2/ http://www.iphods.com/videos/d89fc17d37e6427ec93d261d85640e20.m4v http://www.iphods.com/clips/thumbs/d89fc17d37e6427ec93d261d85640e20.jpg Lesbian Love Vol 2 Lesbian love is in the air in the air! We have four couples who are all natural and engage in intense, passionate love making. Their soft sweet lips match perfectly with each other's lips, breasts and pussies. Get lost in lesbian love with the perfect couples and fall deep into the depths of lesbian lust. 2.5 1 2009-11-26 Mature Adult Nolovelesbianpussiesfourintensenaturallipscouplespassionatebreastscouple http://www.iphods.com/movie/331/girls-with-passion/ http://www.iphods.com/videos/ed545aaccadafd9f831d486d86835716.m4v http://www.iphods.com/clips/thumbs/ed545aaccadafd9f831d486d86835716.jpg Girls With Passion Girls with Passion delivers over two hours of raw salacious sex, the Australian way. The big breasted Chloe leads Irene through her first girl-girl experience. Irene is a quick learner as Chloe soon finds herself in her trademark earth shattering orgasms. In the second scene, Irene is instantly attracted to busty blonde Anneke. These two girls have an undeniable chemistry as they lick, suck, finger and hump their way to orgasmic delight. With squirting, multiple orgasms, real amateur girls and juicy backstage footage, Girls with Passion is HOT! 4.5 1 2009-11-26 Mature Adult Noexperienceorgasmorgasmsblondefootfootageamateurfingersecondlearnjuicysquirtingsquirtirenebustytwo girls http://www.iphods.com/movie/331/girls-with-passion/ http://www.iphods.com/videos/493ca683c7e6aeae3383ac9e5ba67774.m4v http://www.iphods.com/clips/thumbs/493ca683c7e6aeae3383ac9e5ba67774.jpg Girls With Passion Girls with Passion delivers over two hours of raw salacious sex, the Australian way. The big breasted Chloe leads Irene through her first girl-girl experience. Irene is a quick learner as Chloe soon finds herself in her trademark earth shattering orgasms. In the second scene, Irene is instantly attracted to busty blonde Anneke. These two girls have an undeniable chemistry as they lick, suck, finger and hump their way to orgasmic delight. With squirting, multiple orgasms, real amateur girls and juicy backstage footage, Girls with Passion is HOT! 2 1 2009-11-26 Mature Adult Noexperienceorgasmorgasmsblondefootfootageamateurfingersecondlearnjuicysquirtingsquirtirenebustytwo girls http://www.iphods.com/movie/343/natural-tits-2-/ http://www.iphods.com/videos/cdb9bcbe49bf141ac213b11290cd30a4.m4v http://www.iphods.com/clips/thumbs/cdb9bcbe49bf141ac213b11290cd30a4.jpg Natural Tits 2 Beautiful, hot, horny, erect nipples will make you warm and tingly inside and the best news is these gals are au' la natural! They please, tease, and get fucked in every hole! Hardcore cock sucking cum guzzlers that are ohh so nasty vivacious and naturally talented! 2 1 2009-11-20 Mature Adult Nonastysuckinghardcorenaturalnipplesnipple http://www.iphods.com/movie/345/big-boobs-beautiful-feet/ http://www.iphods.com/videos/7f21ef67b5eeee9b531d768822a9851f.m4v http://www.iphods.com/clips/thumbs/7f21ef67b5eeee9b531d768822a9851f.jpg Big Boobs, Beautiful Feet Big Boobs, Beautiful Feet is the latest release from JML Design and stars three sexy barefoot girls ready to fuck and suck. Buxom blonde Lichelle Marie is poolside and ready for some hardcore foot sex. She gets it as Barry worships her size 6 feet before Lichelle stokes his cock with her petite feet. Lichelle then sucks that big cock to get it ready to drill her tight pussy and explode all over her pretty toes. Voluptious latina Mikayla loves to fuck and Jason Marcus gives it to her. First by eating her sweet feet and tasty asshole and then by pounding her tight pussy as her toes curl in pleasure. Busty brunette Rachel Roxxx wraps her tiny size 6 feet around a stiff dick before taking it between her lips and sucking it down her throat. Soon Rachel is hopping up and down on that big cock and spun around in number of positions until Rachel gets a wet finish all over her toes. 2.5 1 2009-11-20 Mature Adult Nosexybeautifultightdicksuckingpleasuresuckprettyhardcoreblondefeetfootthreepoundinghellbrunettetoesbarepositionslipsreleaseassholepoolbustyboobsposition http://www.iphods.com/movie/345/big-boobs-beautiful-feet/ http://www.iphods.com/videos/4de6753e982492b3668264f78ea5d70a.m4v http://www.iphods.com/clips/thumbs/4de6753e982492b3668264f78ea5d70a.jpg Big Boobs, Beautiful Feet Big Boobs, Beautiful Feet is the latest release from JML Design and stars three sexy barefoot girls ready to fuck and suck. Buxom blonde Lichelle Marie is poolside and ready for some hardcore foot sex. She gets it as Barry worships her size 6 feet before Lichelle stokes his cock with her petite feet. Lichelle then sucks that big cock to get it ready to drill her tight pussy and explode all over her pretty toes. Voluptious latina Mikayla loves to fuck and Jason Marcus gives it to her. First by eating her sweet feet and tasty asshole and then by pounding her tight pussy as her toes curl in pleasure. Busty brunette Rachel Roxxx wraps her tiny size 6 feet around a stiff dick before taking it between her lips and sucking it down her throat. Soon Rachel is hopping up and down on that big cock and spun around in number of positions until Rachel gets a wet finish all over her toes. 2 1 2009-11-20 Mature Adult Nosexybeautifultightdicksuckingpleasuresuckprettyhardcoreblondefeetfootthreepoundinghellbrunettetoesbarepositionslipsreleaseassholepoolbustyboobsposition http://www.iphods.com/movie/345/big-boobs-beautiful-feet/ http://www.iphods.com/videos/6f0efbdefa7da214e878673bc5b6f8af.m4v http://www.iphods.com/clips/thumbs/6f0efbdefa7da214e878673bc5b6f8af.jpg Big Boobs, Beautiful Feet Big Boobs, Beautiful Feet is the latest release from JML Design and stars three sexy barefoot girls ready to fuck and suck. Buxom blonde Lichelle Marie is poolside and ready for some hardcore foot sex. She gets it as Barry worships her size 6 feet before Lichelle stokes his cock with her petite feet. Lichelle then sucks that big cock to get it ready to drill her tight pussy and explode all over her pretty toes. Voluptious latina Mikayla loves to fuck and Jason Marcus gives it to her. First by eating her sweet feet and tasty asshole and then by pounding her tight pussy as her toes curl in pleasure. Busty brunette Rachel Roxxx wraps her tiny size 6 feet around a stiff dick before taking it between her lips and sucking it down her throat. Soon Rachel is hopping up and down on that big cock and spun around in number of positions until Rachel gets a wet finish all over her toes. 4.5 1 2009-11-20 Mature Adult Nosexybeautifultightdicksuckingpleasuresuckprettyhardcoreblondefeetfootthreepoundinghellbrunettetoesbarepositionslipsreleaseassholepoolbustyboobsposition http://www.iphods.com/movie/345/big-boobs-beautiful-feet/ http://www.iphods.com/videos/eeee6e539a343aab8e683377fb6b728d.m4v http://www.iphods.com/clips/thumbs/eeee6e539a343aab8e683377fb6b728d.jpg Big Boobs, Beautiful Feet Big Boobs, Beautiful Feet is the latest release from JML Design and stars three sexy barefoot girls ready to fuck and suck. Buxom blonde Lichelle Marie is poolside and ready for some hardcore foot sex. She gets it as Barry worships her size 6 feet before Lichelle stokes his cock with her petite feet. Lichelle then sucks that big cock to get it ready to drill her tight pussy and explode all over her pretty toes. Voluptious latina Mikayla loves to fuck and Jason Marcus gives it to her. First by eating her sweet feet and tasty asshole and then by pounding her tight pussy as her toes curl in pleasure. Busty brunette Rachel Roxxx wraps her tiny size 6 feet around a stiff dick before taking it between her lips and sucking it down her throat. Soon Rachel is hopping up and down on that big cock and spun around in number of positions until Rachel gets a wet finish all over her toes. 2 1 2009-11-20 Mature Adult Nosexybeautifultightdicksuckingpleasuresuckprettyhardcoreblondefeetfootthreepoundinghellbrunettetoesbarepositionslipsreleaseassholepoolbustyboobsposition http://www.iphods.com/movie/371/dueling-dildos-volume-5/ http://www.iphods.com/videos/a01c252d1a9a4ea7fa8e5050a1d17498.m4v http://www.iphods.com/clips/thumbs/a01c252d1a9a4ea7fa8e5050a1d17498.jpg Dueling Dildos Volume 5 You've never seen dildo feens like this ever before! These chicks are beyond horny! They are sex crazed psychos! Cum and watch sexy lesbians in prison! Don't miss out on strap-on action and dildo mania with the hottest chicks you could only dream of fucking! Don't pass this one up! The cream is flowin let's go.MODEL ON BOXCOVER MAY OR MAY NOT APPEAR IN FILM. 3.5 1 2009-10-30 Mature Adult Nosexylesbianhottesthornylesbianschicksdildocreamchick http://www.iphods.com/movie/371/dueling-dildos-volume-5/ http://www.iphods.com/videos/b2b550e99b75fd19d3f0d08796116623.m4v http://www.iphods.com/clips/thumbs/b2b550e99b75fd19d3f0d08796116623.jpg Dueling Dildos Volume 5 You've never seen dildo feens like this ever before! These chicks are beyond horny! They are sex crazed psychos! Cum and watch sexy lesbians in prison! Don't miss out on strap-on action and dildo mania with the hottest chicks you could only dream of fucking! Don't pass this one up! The cream is flowin let's go.MODEL ON BOXCOVER MAY OR MAY NOT APPEAR IN FILM. 5 1 2009-10-30 Mature Adult Nosexylesbianhottesthornylesbianschicksdildocreamchick http://www.iphods.com/movie/375/strap-on-workout-vol-7/ http://www.iphods.com/videos/1aac4e1d5ecd5d955210fc32a2d043d9.m4v http://www.iphods.com/clips/thumbs/1aac4e1d5ecd5d955210fc32a2d043d9.jpg Strap-On Workout Vol. 7 Due to my muscularity, physical conditioning, and always-hard cock, I can out fuck a man and now I have met a woman that can handle it. Kelly Estelle is in excellent physical shape and absolutely loves to fuck! Not only does she know her way around a gym she knows her way around a bedroom and it shows. The girl is totally buff with massive legs, toned arms and a strong, well-developed back. She is my kind of woman! In this video Kelly joins me in my private gym where we workout and pump up our muscular bodies. We flex and pose for you before getting into some serious fuck and suck strap-on cock action. Kelly eats my pierced pussy, fucks a suction cup dildo, enjoys two of my most powerful vibrators, and takes all the hard cock I can slam and cram into her pussy. Kelly cums often and hard, shaking and trembling uncontrollably as I slam her cunt deep and hard with my strap-on rubber cock. She screams and cries put loud as she reaches intense total body orgasms. I just love fucking this girl and you will love 4 1 2009-10-23 Mature Adult Nopussyfuckingbodywomansuckorgasmorgasmslegsdildokellyintenselovesfucksalwaysjoinmassivecreambedroomcumsrubbercuntpumpvibratorpower http://www.iphods.com/movie/407/barefoot-captivity/ http://www.iphods.com/videos/c702484e4350af99a548d63a9ac4e8ae.m4v http://www.iphods.com/clips/thumbs/c702484e4350af99a548d63a9ac4e8ae.jpg Barefoot Captivity Sexy XXX star Francesca Le' is one tough cookie - but when she bets Bryan Davis that she can take anything he can dish out, she may have dived in a bit too deep! The pretty brunette is kept in intense bondage, accented nicely by her lack of footwear. That's right; she spends her dungeon time barefoot, bound and utterly helpless! Francesca's experience here is INTENSE! 4.5 1 2009-10-08 Mature Adult Nobondageboundexperiencenicedeepprettyanythingfootintensebrunettebaredungeonendshelpless http://www.iphods.com/movie/408/girls-with-desire/ http://www.iphods.com/videos/8668a363552165fa3e4c84c7d4de8500.m4v http://www.iphods.com/clips/thumbs/8668a363552165fa3e4c84c7d4de8500.jpg Girls With Desire 2009 AVN Award Nominee for Best Amateur ReleaseSexual tension, carnal passion and raw horniness, Girls with Desire shows what girl-girl action is all about in two deliciously filthy scenes. Raven-haired, big breasted, seductively curvaceous and a fan of anal, Angie is the ultimate lover. In a barnyard amongst the haystacks, she wastes no time in the first scenes staring Chloe, as she hungrily devours every part of her partner's body. Fast and hard, orgasm after orgasm, this big breasted duo don't stop until they're both left gasping for air. In her next scene, Angie's fervid tongue introduces Shaminee to her first on-camera girl-girl experience in an abandoned warehouse. Shaminee is a quick learner. She utilizes all her piercings to full effect, as these kinky girls experiment with anal, licking and sucking their way to multiple orgasms. Bonus solo videos of Chloe and Marigold demonstrating their new vibrators, plus stacks of other interviews and behind the scenes footage. 3 1 2009-10-03 Mature Adult Nogirlsuckingexperiencevideosuckorgasmsfoottonguekinkycamerabehindlickingnomineeawardfootageamateurlearnhairreleaseavn awardaward nomineebonuslovervibratorultimateviewpartnervideosfilthy http://www.iphods.com/movie/411/the-anal-girls-of-tobacco-road-volume-3/ http://www.iphods.com/videos/995999a0c530f3956f3f298b426693d4.m4v http://www.iphods.com/clips/thumbs/995999a0c530f3956f3f298b426693d4.jpg The Anal Girls of Tobacco Road Volume 3 You would walk a mile for a camel but wouldn't you rather have some ASS!! Well with this, you get both. These horny smoke freaks love to fuck while smoking cigarettes and they are really good at handling both cock, smoking. Now that's a keep, you think? Get some extra flavor in every ass!! 5 1 2009-10-03 Mature Adult Noloveextrasmokingsmoke http://www.iphods.com/movie/414/big-titty-white-girls-2/ http://www.iphods.com/videos/a7b1b85ada8725f0087880d2546f8e6f.m4v http://www.iphods.com/clips/thumbs/a7b1b85ada8725f0087880d2546f8e6f.jpg Big Titty White Girls 2 Man, we did it again... Brought y'all them white girls wit big old titties. All of 'em were juicy. Why is it that the girls with the biggest titties love the deepest dickin? Justin Slayer and buddy Nat go buck wild on some pretty white girls... the kind who just happen to have bra-busting racks, like voluptuous dreamboat Lorena Blonde. These top-heavy white sluts go knockers-up for big black cock! 2 1 2009-10-03 Mature Adult Nodickwildblackprettywhitejuicyheavybig blackvoluptuousbiggest http://www.iphods.com/movie/431/sole-to-soul/ http://www.iphods.com/videos/2ef5dc97aee6d29aca0e9b4d3ec92092.m4v http://www.iphods.com/clips/thumbs/2ef5dc97aee6d29aca0e9b4d3ec92092.jpg Sole To Soul! Vinyl Queen and Jackie MagicFeet meet again for another trampling session with Carpet Kid. Vinyl Queen starts things off by getting her heels into his chest first. She first dons a pair of black, patent leather slingbacks. The sharp heels get eaten up by CK's flesh as the full-body angle shows her pressing into him again and again. Next it's time for some vicious metal-heeled mules. Close-ups show the heels disappearing deep inside! VQ finishes her turn with black, strappy platforms. You'll think they aren't platforms as the shoe just keeps disappearing - Vinyl Queen places such concentrated force onto her feet! Jackie MagicFeet joins Vinyl Queen to double trample Carpet Kid. Both ladies wear clear-heeled shoes as they walk all over their rug. Carpet Kid can hardly stand the abuse so they transition to pantyhose-clad feet in order not to use him up too early. Plenty of stomping, face standing, and jumping happens, as they don't really give CK a break at all. For the finale, VQ and Jackie MagicFee 2.5 1 2009-09-18 Mature Adult Noladiesleatherdeepforceddoubleblackfeetfootfetishjointoesbarereleaseshoesheelspantyhosequeenclosepairdeep inside http://www.iphods.com/movie/436/playtimes-nudes-presents-carli-banks/ http://www.iphods.com/videos/a582c2bfea35c4290b16e6b783545f47.m4v http://www.iphods.com/clips/thumbs/a582c2bfea35c4290b16e6b783545f47.jpg Playtimes Nudes Presents - Carli Banks Everyone's Favorite Sweetheart returns! Carli's Come Back and She's Got a Big Surprise! Her First Anal Ever! Anal Play with Fingers and Vibrator. Love Doll! Instructions! Up-close and Personal "Alone Time." Pussy Play with Toys and Fingers! Not Mean, Just A Non-Stop Stream of Sweet, Coaxing, Teasing J/O Talk! Carli will Seduce You and Drain You Dry! Don't Miss Carli's Anal Premier for Playtime! Carli's back and she's not mean like last time - she's sweet and sensual, posing in her tan stockings and tight white top. "Are you stroking your penis right now?," she asks, warning you not to cum too soon. Lots of up skirt views of her slim 20-year-old body and nearly bald kitty. Stripping to black panties, she spreads her legs wide. "Does that get your dick nice and hard?" she teases. JO commands as she shows off her full, natural breasts and rubs her tasty muffin. "Are you getting ready to squirt it all over my body? You're so fucking naughty." Carli pulls out a long purple vibrator, licking and sucking it. She ba 4.5 1 2009-09-16 Mature Adult Noyoungtitstightdicksuckingniceverysuckplayblackorgasmdoeswhitelegsbottomridelickingtoyshighnaturalnaughtysurprisealonemassivefavoritecleanteasingbedroomblowpullssquirt,panties,asshole,carli,fingers,lingerie,kitty,stockings,breasts,vibrator,spread,naked,couple,view,bang,close,clit http://www.iphods.com/movie/436/playtimes-nudes-presents-carli-banks/ http://www.iphods.com/videos/de2780d550a32a5aa31dab2ebb7da236.m4v http://www.iphods.com/clips/thumbs/de2780d550a32a5aa31dab2ebb7da236.jpg Playtimes Nudes Presents - Carli Banks Everyone's Favorite Sweetheart returns! Carli's Come Back and She's Got a Big Surprise! Her First Anal Ever! Anal Play with Fingers and Vibrator. Love Doll! Instructions! Up-close and Personal "Alone Time." Pussy Play with Toys and Fingers! Not Mean, Just A Non-Stop Stream of Sweet, Coaxing, Teasing J/O Talk! Carli will Seduce You and Drain You Dry! Don't Miss Carli's Anal Premier for Playtime! Carli's back and she's not mean like last time - she's sweet and sensual, posing in her tan stockings and tight white top. "Are you stroking your penis right now?," she asks, warning you not to cum too soon. Lots of up skirt views of her slim 20-year-old body and nearly bald kitty. Stripping to black panties, she spreads her legs wide. "Does that get your dick nice and hard?" she teases. JO commands as she shows off her full, natural breasts and rubs her tasty muffin. "Are you getting ready to squirt it all over my body? You're so fucking naughty." Carli pulls out a long purple vibrator, licking and sucking it. She ba 4 1 2009-09-16 Mature Adult Noyoungtitstightdicksuckingniceverysuckplayblackorgasmdoeswhitelegsbottomridelickingtoyshighnaturalnaughtysurprisealonemassivefavoritecleanteasingbedroomblowpullssquirt,panties,asshole,carli,fingers,lingerie,kitty,stockings,breasts,vibrator,spread,naked,couple,view,bang,close,clit http://www.iphods.com/movie/443/i-need-to-pee-14/ http://www.iphods.com/videos/288cc0d26ed1ec3f822b3b1549721f96.m4v http://www.iphods.com/clips/thumbs/288cc0d26ed1ec3f822b3b1549721f96.jpg I Need To Pee 14 You do it. I do it. Everyone does it. I am of course referring to the act of urination. Pissing. Peeing. Whizzing. Whatever you want to call it, we've all been stuck in hopeless situations where we were stuck - perhaps locked out of our house - with our bladders about to burst. Well in this flick right here, you get to see what happens when these lovely ladies absolutely cannot hold it in any longer! 5 1 2009-09-12 Mature Adult Noladiesdoescalllovely http://www.iphods.com/movie/445/mad-sex-party-custard-fuck/ http://www.iphods.com/videos/29983fad7b89ea2eb7cc2de30b4da2ce.m4v http://www.iphods.com/clips/thumbs/29983fad7b89ea2eb7cc2de30b4da2ce.jpg Mad Sex Party - Custard Fuck Mad Sex Party presents another snatch-filled blowout packed with a whole slew of different horny hotties starring in a double feature of fuckfest flicks! Cream Girls is a girls-only, beaver bumpin sex party, jam-packed with babes slathers in slick body lotion, sliding up, down, in and out of each other's tight bodies, getting each other off in ways only girls know how. Custard Fuck catches a gang of jacked-up jocks and Jills getting' jiggy like piggies in a sloppy, sticky pudding-drenched orgy that's sure to satisfy your sexual sweet tooth! 4 1 2009-09-12 Mature Adult Nogirlspartybodydoublefilledhottiesblowfestorgyfeature http://www.iphods.com/movie/450/east-coast-assault/ http://www.iphods.com/videos/dbfa3a6f3596c1120cd197455659a62f.m4v http://www.iphods.com/clips/thumbs/dbfa3a6f3596c1120cd197455659a62f.jpg East Coast ASSault Jules tries to take a vacation but keeps running into sluts who want to show off for his camera... Most of 'em taking it up the ass. He invades the ENTIRE EAST COAST: New York City, Philadelphia, Montreal, and Baltimore. So much hardcore anal action the coast will never be the same! 4.5 1 2009-09-11 Mature Adult Noanalcamerahardcore anal http://www.iphods.com/movie/455/rough-house-body-kombat/ http://www.iphods.com/videos/5ab1ddab641ef0850e23c84107b2277f.m4v http://www.iphods.com/clips/thumbs/5ab1ddab641ef0850e23c84107b2277f.jpg Rough-House Body Kombat It's UTAH vs. SHELLEY in a tough, nude body-banging from our Veteran cat-fighters. Energetic! Intense catfighting, breast rubbing and touching between two buxom beauties who have it out for one another! See who wins in this knockout body combat free for all! 4 1 2009-09-05 Mature Adult Nobodyhellintensebangfree http://www.iphods.com/movie/460/milf-frenzy/ http://www.iphods.com/videos/865c7c034e5d29b3bae8e753356c8961.m4v http://www.iphods.com/clips/thumbs/865c7c034e5d29b3bae8e753356c8961.jpg MILF Frenzy It is a frenzy of MILF and you are invited as the moms from next door gets butt fucked time and time again. Who knew mom could fuck like a champ; some might even say she is better at fucking than someone half her age! These MILFs are worked up and ready to get pounded by the fountain of youth. 5 1 2009-09-04 Mature Adult Nofuckingevenbuttmomsmilfmilfs http://www.iphods.com/movie/462/my-first-black-cock-7-milf-edition/ http://www.iphods.com/videos/757f0c35253fd354efcd7f90799e3b4a.m4v http://www.iphods.com/clips/thumbs/757f0c35253fd354efcd7f90799e3b4a.jpg My First Black Cock 7 - MILF Edition I was watching a really hot porn DVD with this hot Black guy and his huge cock fucking every chick in sight! I'd never seen anything that big, or that stayed so hard for so long. I had to try it. So I did! Girls, until you've had a massive Black rod up your pussy or your ass- you ain't had nothin' yet. And those Black studs really love us moms, we love to fuck and so do they. So I waited a long time for my first Black cock, but it was worth it... every time my old man goes on a business trip, I go on a 'Black cock' trip! Once you try it, you'll be Black Cockin' for good... and that's real good! 2.5 1 2009-09-03 Mature Adult Nopussyfuckingstudsverypornanythinghugemassivechickmomsbusiness http://www.iphods.com/movie/462/my-first-black-cock-7-milf-edition/ http://www.iphods.com/videos/54f03ce717d2f1b54e66bb2020e0c808.m4v http://www.iphods.com/clips/thumbs/54f03ce717d2f1b54e66bb2020e0c808.jpg My First Black Cock 7 - MILF Edition I was watching a really hot porn DVD with this hot Black guy and his huge cock fucking every chick in sight! I'd never seen anything that big, or that stayed so hard for so long. I had to try it. So I did! Girls, until you've had a massive Black rod up your pussy or your ass- you ain't had nothin' yet. And those Black studs really love us moms, we love to fuck and so do they. So I waited a long time for my first Black cock, but it was worth it... every time my old man goes on a business trip, I go on a 'Black cock' trip! Once you try it, you'll be Black Cockin' for good... and that's real good! 5 1 2009-09-03 Mature Adult Nopussyfuckingstudsverypornanythinghugemassivechickmomsbusiness http://www.iphods.com/movie/464/fuck-mom-me-4/ http://www.iphods.com/videos/68d6b3cbdb083e5256ad4428617dd8f2.m4v http://www.iphods.com/clips/thumbs/68d6b3cbdb083e5256ad4428617dd8f2.jpg Fuck Mom Me 4 Watch mother and daughter slurp on the same big cock! See how their pussies are similar in looks and taste! Audrianna wasn't happy with her boyfriend's little cock, so she came with her mom Kristina to Porn Valley to make some quick cash and to fuck some big dicks! Marie didn't inherit her mom Darryl's huge clit but don't worry, she got her Grandma's perky tits and tight snatch! Kendra and Bailey agree that nothing makes a cock taste better than the sweet flavor of a family member's pussy! Cameron was nervous about having a tongue jammed up her ass for the first time, so she brought her depraved whore of a mother Victoria along for moral support. 2 1 2009-09-02 Mature Adult Nocockpussytitstightpornpussiestongueboyfriendhugeoralfirst timehappydicksdaughterkrisclit http://www.iphods.com/movie/464/fuck-mom-me-4/ http://www.iphods.com/videos/5a2b76bcf5abe529167c90a5c0f04e0a.m4v http://www.iphods.com/clips/thumbs/5a2b76bcf5abe529167c90a5c0f04e0a.jpg Fuck Mom Me 4 Watch mother and daughter slurp on the same big cock! See how their pussies are similar in looks and taste! Audrianna wasn't happy with her boyfriend's little cock, so she came with her mom Kristina to Porn Valley to make some quick cash and to fuck some big dicks! Marie didn't inherit her mom Darryl's huge clit but don't worry, she got her Grandma's perky tits and tight snatch! Kendra and Bailey agree that nothing makes a cock taste better than the sweet flavor of a family member's pussy! Cameron was nervous about having a tongue jammed up her ass for the first time, so she brought her depraved whore of a mother Victoria along for moral support. 5 1 2009-09-02 Mature Adult Nocockpussytitstightpornpussiestongueboyfriendhugeoralfirst timehappydicksdaughterkrisclit http://www.iphods.com/movie/465/lick-bush-in-2000-volume-4/ http://www.iphods.com/videos/225a520088cc4cb1d1aa0c598df3eecd.m4v http://www.iphods.com/clips/thumbs/225a520088cc4cb1d1aa0c598df3eecd.jpg Lick Bush In 2000 Volume 4 Let's get one thing completely straight: this movie doesn't have a damn thing to do with politics. Amen to that! This Bush is much better than the Texan we have in office. Pussy licking, pussy fingering, and pussy pounding are the three main points this movie touches on. God bless America! If you don't masturbate like a monkey at the zoo then the turrists have won! 5 1 2009-08-29 Mature Adult Nopussydoesthreepoundinglickingfingerofficecompletelycomplete http://www.iphods.com/movie/467/girls-kissing-girls/ http://www.iphods.com/videos/a63869b049eb59b1f37f3bbff4fbf843.m4v http://www.iphods.com/clips/thumbs/a63869b049eb59b1f37f3bbff4fbf843.jpg Girls Kissing Girls 2009 Feminist Porn Award Nominee.2009 AVN Award Nominee for Best All-Girl ReleaseLesbians love to kiss, and this video pays homage to the lost art of osculation. In this hot, romantic video, young girls take their time exploring the lips, tongues, and mouths of their sexy young lovers. Top lesbian star Elexis Monroe, adorable young Annabelle Lee, and stunning redhead Mz. Berlin let their passions for each other run wild, while Trinity Post shows submissive Sinn Sage how to enjoy the art of lesbian tongue-play. 2 1 2009-08-28 Mature Adult Nogirlslovesexylesbianwildvideoplaylesbianstonguesubmissivekissnomineeberlinawardlipsfeministfeminist pornreleasemouthsaward nomineeloverslover http://www.iphods.com/movie/468/transworld-5/ http://www.iphods.com/videos/e8f5daf99cd69098ee983cef01ee11b0.m4v http://www.iphods.com/clips/thumbs/e8f5daf99cd69098ee983cef01ee11b0.jpg Transworld 5 3 Vision Entertainment continues the hot Transworld series with the best of she-male talent in Transworld 5. Sucking, fucking, and craving cum filled cocks that is guaranteed to be a sticky delight. Director Ludo Perre knows exactly what you want and he delivers. 5 1 2009-08-28 Mature Adult Nofuckingsuckingcocksfilledcravingdirectorcontinuesmale http://www.iphods.com/movie/469/1st-time-black-amateurs-5/ http://www.iphods.com/videos/40b14f78f9a2f2d938bc8dc2a96d7567.m4v http://www.iphods.com/clips/thumbs/40b14f78f9a2f2d938bc8dc2a96d7567.jpg 1st Time Black Amateurs 5 Here is the freshest black beauties you can see anywhere! This set of beginners is so proper. Beautiful Sole is so pretty and smooth skinned! Nina has got the bombest pussy ever and a big fat ass... and she's pretty, pretty! Devin is a brand new sexy thing from Arizona! Plus more! 5 1 2009-08-28 Mature Adult Nopussybeautifulblackprettyropeskinnina http://www.iphods.com/movie/470/pantyhose-sextease/ http://www.iphods.com/videos/d6bbe2a9bd4a5d1e2470a4e64db43198.m4v http://www.iphods.com/clips/thumbs/d6bbe2a9bd4a5d1e2470a4e64db43198.jpg Pantyhose Sextease Some babes will do whatever it takes to get you hotter, harder, and hornier when engaging in sexual bliss!! Watch as she pulls on her pantyhose and rips them in the crotch so that you can access her sweet twat from the front or the back!! She may be an amateur, but she knows how to please!!! 2.5 1 2009-08-28 Mature Adult Nosexualamateurcrotchhotterpullspantyhose http://www.iphods.com/movie/470/pantyhose-sextease/ http://www.iphods.com/videos/68b488e843c5bbb88bf2181c6c7e77b1.m4v http://www.iphods.com/clips/thumbs/68b488e843c5bbb88bf2181c6c7e77b1.jpg Pantyhose Sextease Some babes will do whatever it takes to get you hotter, harder, and hornier when engaging in sexual bliss!! Watch as she pulls on her pantyhose and rips them in the crotch so that you can access her sweet twat from the front or the back!! She may be an amateur, but she knows how to please!!! 4.5 1 2009-08-28 Mature Adult Nosexualamateurcrotchhotterpullspantyhose http://www.iphods.com/movie/472/splosh-fest/ http://www.iphods.com/videos/6381f588a40330f36fbc7de423e6a374.m4v http://www.iphods.com/clips/thumbs/6381f588a40330f36fbc7de423e6a374.jpg Splosh Fest If you like your women beautiful, muscular, nude and covered in food then this is the video for you! You guys into Splosh videos know what I am talking about. Women dipping their beautiful bare feet into Jell-O or pouring Tapioca on their tushy. Bathing themselves in food. It is hot and it is here in Goddess Heather's first Splosh video - "Splosh Fest!" Watch as Goddess Heather (with ten chains hanging from her beautiful pussy rings) covers herself in colorful food. The viewer gets a real glimpse of Goddess Heather's personality and sense of humor plus there is nothing quite like watching a fresh cherry pie covered with whipping cream gushing out from between a set of beautiful thighs. Packing your pussy with pie, now that's what makes this country great! Now that's entertainment!! 2 1 2009-08-28 Mature Adult Noguysvideofeethighwhippingbarecoveredwhipcreamfestgoddessviewvideos http://www.iphods.com/movie/474/chicks-salsa-5/ http://www.iphods.com/videos/7e2b68306dfaea92191a12094e067473.m4v http://www.iphods.com/clips/thumbs/7e2b68306dfaea92191a12094e067473.jpg Chicks and Salsa 5 2009 AVN Award Nominee for Best Ethnic Themed Release - LatinThese spicy sluts are guaranteed to leave your balls on fire! With their soft, moist lips and tight, hard asses, these luscious and loose Latinas are guaranteed to leave your chimichanga dripping hot sauce! You'd swear that their immigration status depended on how much cock they sucked and fucked, as these mating mamacitas go cock loco! 3 1 2009-08-28 Mature Adult Nococktightballssuckslutnomineeawarddrippinglipsreleaseaward nomineeassesball http://www.iphods.com/movie/474/chicks-salsa-5/ http://www.iphods.com/videos/392d5ac36cd4b5bcd8c9b880684ff6a3.m4v http://www.iphods.com/clips/thumbs/392d5ac36cd4b5bcd8c9b880684ff6a3.jpg Chicks and Salsa 5 2009 AVN Award Nominee for Best Ethnic Themed Release - LatinThese spicy sluts are guaranteed to leave your balls on fire! With their soft, moist lips and tight, hard asses, these luscious and loose Latinas are guaranteed to leave your chimichanga dripping hot sauce! You'd swear that their immigration status depended on how much cock they sucked and fucked, as these mating mamacitas go cock loco! 5 1 2009-08-28 Mature Adult Nococktightballssuckslutnomineeawarddrippinglipsreleaseaward nomineeassesball http://www.iphods.com/movie/474/chicks-salsa-5/ http://www.iphods.com/videos/0db471a0db69134383775286f9fecb34.m4v http://www.iphods.com/clips/thumbs/0db471a0db69134383775286f9fecb34.jpg Chicks and Salsa 5 2009 AVN Award Nominee for Best Ethnic Themed Release - LatinThese spicy sluts are guaranteed to leave your balls on fire! With their soft, moist lips and tight, hard asses, these luscious and loose Latinas are guaranteed to leave your chimichanga dripping hot sauce! You'd swear that their immigration status depended on how much cock they sucked and fucked, as these mating mamacitas go cock loco! 2 1 2009-08-28 Mature Adult Nococktightballssuckslutnomineeawarddrippinglipsreleaseaward nomineeassesball http://www.iphods.com/movie/476/the-make-up/ http://www.iphods.com/videos/ebb61c38fafe1395be7580dcf56ec9bc.m4v http://www.iphods.com/clips/thumbs/ebb61c38fafe1395be7580dcf56ec9bc.jpg The Make Up A couple must decide: Break up or make up? Mandy and Spencer are having relationship issues... He wants to get married while she wants to break up. When Spencer asks his Dad for advice, Mandy and Spencer end up at a resort for troubled couples. The only problem is Dad never told them what kind of resort this really was!!! 2.5 1 2009-08-27 Mature Adult Nocouplescoupledecide http://www.iphods.com/movie/476/the-make-up/ http://www.iphods.com/videos/e23cf5a19577e660036f475e43e8756d.m4v http://www.iphods.com/clips/thumbs/e23cf5a19577e660036f475e43e8756d.jpg The Make Up A couple must decide: Break up or make up? Mandy and Spencer are having relationship issues... He wants to get married while she wants to break up. When Spencer asks his Dad for advice, Mandy and Spencer end up at a resort for troubled couples. The only problem is Dad never told them what kind of resort this really was!!! 5 1 2009-08-27 Mature Adult Nocouplescoupledecide http://www.iphods.com/movie/477/hot-blooded/ http://www.iphods.com/videos/ce6762524be7988e8886f4dea0552d08.m4v http://www.iphods.com/clips/thumbs/ce6762524be7988e8886f4dea0552d08.jpg Hot Blooded Three promiscuous young women launch a provocative plan to boost business in the local video store. The HOT BLOODED shop girls give patrons all the service one could ever imagine! It is not too long before sales shoot through the roof! And not long before hot loads shoot into these sluts mouths! 4 1 2009-08-27 Mature Adult Nogirlyoungwomenvideomouthslutthreemouthsshootbusiness http://www.iphods.com/movie/477/hot-blooded/ http://www.iphods.com/videos/4a282ad7993ff623962135a8c4bfe60f.m4v http://www.iphods.com/clips/thumbs/4a282ad7993ff623962135a8c4bfe60f.jpg Hot Blooded Three promiscuous young women launch a provocative plan to boost business in the local video store. The HOT BLOODED shop girls give patrons all the service one could ever imagine! It is not too long before sales shoot through the roof! And not long before hot loads shoot into these sluts mouths! 2.5 1 2009-08-27 Mature Adult Nogirlyoungwomenvideomouthslutthreemouthsshootbusiness http://www.iphods.com/movie/478/wpink-tv/ http://www.iphods.com/videos/676dec8542d2fa19ef280b4cfd6dc625.m4v http://www.iphods.com/clips/thumbs/676dec8542d2fa19ef280b4cfd6dc625.jpg WPINK TV TV cameraman Phil (Ron Jeremy) turns up with a brazen plan for a "sex-rated" past-prime-time program after watching girlfriend Cathy (Christy Canyon) turning on for his private video viewing pleasure. Phil and his crew start the ball rolling with some pulse-stopping aerobics that unbeknownst to the group have been picked up by satellite and beamed around-the-world; launching an investigation led by super-agent Scorpio (Harry Reems). Disguised as a maintenance engineer, Harry is nevertheless quickly spotted as Cathy can't help but notice his gear. Cast and crew continue to make air-waves with special guest star, John Holmes, who holds his own against a panel of experts on Beat The Cock. Behind the scenes, Bambi lens the director a helping hand and Harry convinces Cathy he is ready, willing and more than able to handle his share of the load. Meanwhile a network of foreign and domestic audiences are new desperately trying to horn in on Scorpio's undercover operation. Finally, the lights are dimmed, the cameras s 4 1 2009-08-27 Mature Adult Nofinallyvideoplaycamerabehindgroupwillingjoindarkcaughtblowdirectorjeremyballviewgirlfriendslowly http://www.iphods.com/movie/479/ron-jeremy-screws-the-stars/ http://www.iphods.com/videos/567859913b90f76c0c56fae1decacd53.m4v http://www.iphods.com/clips/thumbs/567859913b90f76c0c56fae1decacd53.jpg Ron Jeremy Screws The Stars Watch the stars as they do each other! Non-Stop Star Studded Action! A unique collection never assembled before. Every scene is a hit, every scene is a classic! Watch as these lovely vixens take on the "KING OF PORN," Ron Jeremy. These are real girls with big hair, natural boobs and fuzzy beavers. This is classic porn at its best. They don't make them like this anymore! 3 1 2009-08-27 Mature Adult Nolovepornnaturalhairclassiccollectionjeremylovelyboobs http://www.iphods.com/movie/480/deep-inside-samantha-fox/ http://www.iphods.com/videos/9545e37de1b4c5e63ed0bc18a3e4a3dc.m4v http://www.iphods.com/clips/thumbs/9545e37de1b4c5e63ed0bc18a3e4a3dc.jpg Deep Inside Samantha Fox Samantha Fox was born in NYC in the 1950's. Throughout her younger years she became heavily involved in dance, eventually dancing as a professional. She is an intense and sizzling brunette, with a gorgeous body. Her first adult role was in the Video-X-Pix hit, Bad Penny (1978), directed by Chuck Vincent. After this, she began to take on lead roles as an adult starlet and shortly after entering the industry Samantha was already on her way to legendary status. She was indeed a true gem of the age. Her on screen chemistry and scenes with performer/husband, Bobby Astyr, were among the most entertaining of all time. This collection of Samantha Fox's most erotic scenes from the VXP vault is a must have for any serious collector of Golden Age Erotica. This is vintage porn at it's finest. 4 1 2009-08-27 Mature Adult Nobodyvideoevenpornintensebrunetteeroticshorthusbandadultcollectiondancingeventually http://www.iphods.com/movie/481/pleasure-principal/ http://www.iphods.com/videos/541f6c57ff1c5482621f2a6e5c470ccb.m4v http://www.iphods.com/clips/thumbs/541f6c57ff1c5482621f2a6e5c470ccb.jpg pleasure principal Ron Jeremy is our guide on a journey through the ages of sexual repression, shame and guilt. Come along as he helps dispel the age old belief that sex is bad. In fact, Ron will show us that sex is good... very, very good. From trailers, to strangers in a dining room, to the newly rented hotel room of newlyweds, explore the PLEASURE PRINCIPLE. 3.5 1 2009-08-27 Mature Adult Nopleasuresexualjeremy http://www.iphods.com/movie/482/ball-in-the-family/ http://www.iphods.com/videos/05020f857106941f0ff44eb4351684df.m4v http://www.iphods.com/clips/thumbs/05020f857106941f0ff44eb4351684df.jpg Ball In The Family Itchy and Eatit Bonker have a nice house in Queens, a very beautiful daughter who is a nymphomaniac, a mooching son-in-law who is hung like horse, and a fondness for fooling around every chance they get. Come spend a day with them as they try to keep it, Ball in the Family. 3.5 1 2009-08-27 Mature Adult Nonicedaughterballqueen http://www.iphods.com/movie/483/you-make-me-wet/ http://www.iphods.com/videos/1cb4e443cc7f0a0d4a74f9d3eca55cc0.m4v http://www.iphods.com/clips/thumbs/1cb4e443cc7f0a0d4a74f9d3eca55cc0.jpg You Make Me Wet Love and jealously make strange bedfellows. The fur flies and the juices run rampant when Maude and Tracy combine their fleshly pleasures in strange, unusual, and exciting ways - but that doesn't stop them from venting their lustful desires with other girls and guys. The sensual flames burn brightly, exploding into an all-out conflagration when the two girls get together with a mutual boyfriend to experience the ultimate fulfillment. 4.5 1 2009-08-27 Mature Adult Nogirlsloveexperienceguysdoesboyfriendultimatetwo girls http://www.iphods.com/movie/484/concetta-licata/ http://www.iphods.com/videos/f467d3c793a3920afd5f1fe25934d4bf.m4v http://www.iphods.com/clips/thumbs/f467d3c793a3920afd5f1fe25934d4bf.jpg Concetta Licata The grandmaster of Italian hardcore, Mario Salieri, has garnered one award after the other. He's made another innovative film once again! Going even further with his XXX ideas! A diabolical story, with sublime images and violent, humiliating situations, not to forget 25 hardcore fuckers of both sexes! This mega budget saga is sure to send shivers up your spine! 3 1 2009-08-27 Mature Adult Nomasterfilmevenstory http://www.iphods.com/movie/484/concetta-licata/ http://www.iphods.com/videos/ab9ca1ec706b5cdae08f0a033cf77ad5.m4v http://www.iphods.com/clips/thumbs/ab9ca1ec706b5cdae08f0a033cf77ad5.jpg Concetta Licata The grandmaster of Italian hardcore, Mario Salieri, has garnered one award after the other. He's made another innovative film once again! Going even further with his XXX ideas! A diabolical story, with sublime images and violent, humiliating situations, not to forget 25 hardcore fuckers of both sexes! This mega budget saga is sure to send shivers up your spine! 2.5 1 2009-08-27 Mature Adult Nomasterfilmevenstory http://www.iphods.com/movie/486/nurse-my-cock/ http://www.iphods.com/videos/36c11ac080365dae7dce5e409080ea3c.m4v http://www.iphods.com/clips/thumbs/36c11ac080365dae7dce5e409080ea3c.jpg Nurse My Cock The hospital bed becomes a cum soaked playground for cock craving nurses in this 2-hour ode to the hardcore hospital films of the 1970's! Vanessa and Leslie are working the late shift together, but need to take a break to pleasure each other's horny little assholes. Super skinny Marlene is a hot nurse who likes to finger her ass while she gets fucked and drinks cum. The doctor catches Ron Jeremy fucking his nurse, so he slides his dick up her ass to fill both holes! Over 17 loops packed with sultry uniformed nurses in ass packing, double penetration, and anal lesbian action are guaranteed to leave your bedpan filled with cum! 4 1 2009-08-27 Mature Adult Nolesbiandickhornypleasurefilmdoubleanalplayfilledassholesfingercravingskinassholejeremyfilmsnursepenetration http://www.iphods.com/movie/488/hellcats-14/ http://www.iphods.com/videos/3c1db5c7d178243d31e93ac9fdcbb1b0.m4v http://www.iphods.com/clips/thumbs/3c1db5c7d178243d31e93ac9fdcbb1b0.jpg Hellcats 14 Watch sexually wild bitches get crazy for the perverse camera of Joey Silvera! Fine blonde Riley Evans has a pair of excellent, big, natural knockers. Jerry sucks those fat tits, fingers and snacks on her pussy and fucks her cowgirl-style, with a lengthy titfucking session, anal sex and a climactic cumshot all over her mouth and chest. Rachel Love's a cute brunette who masturbates until Bad Bob and Joey start manhandling her; she gets a brutal throatfucking from Joey and even eats his ass while Bob fucks her! Both guys use her asshole and jizz in her mouth. Sparkly slut Sunny Lane licks hot Leah Stevenson's wet cunt, and the girls kiss. Derrick Pierce goes down on Sunny's pussy then enjoys a double BJ from both girls. Afterward, Derrick fucks Sunny while she eats out Leah, then he fucks Leah's butt (while the ladies take turns using a vibrator on themselves) and cums on both of their faces. And sexy Hannah West dominates Heather Gables in a scene that includes the girls rimming each other's asshole, facesitti 5 1 2009-08-26 Mature Adult Notitsfuckingladiesfinallyguyswilddoublesuckanalblondemouthslutcamerabuttkissbrunettestyletoysnaturalfuckscutefingerincludesfacesittingbitchescleanlipssmokingcumsassholefaces,fingers,cunt,vibrator,sexually,pair http://www.iphods.com/movie/488/hellcats-14/ http://www.iphods.com/videos/520b39ea57aeb21dbbf07b71bd2f0ca9.m4v http://www.iphods.com/clips/thumbs/520b39ea57aeb21dbbf07b71bd2f0ca9.jpg Hellcats 14 Watch sexually wild bitches get crazy for the perverse camera of Joey Silvera! Fine blonde Riley Evans has a pair of excellent, big, natural knockers. Jerry sucks those fat tits, fingers and snacks on her pussy and fucks her cowgirl-style, with a lengthy titfucking session, anal sex and a climactic cumshot all over her mouth and chest. Rachel Love's a cute brunette who masturbates until Bad Bob and Joey start manhandling her; she gets a brutal throatfucking from Joey and even eats his ass while Bob fucks her! Both guys use her asshole and jizz in her mouth. Sparkly slut Sunny Lane licks hot Leah Stevenson's wet cunt, and the girls kiss. Derrick Pierce goes down on Sunny's pussy then enjoys a double BJ from both girls. Afterward, Derrick fucks Sunny while she eats out Leah, then he fucks Leah's butt (while the ladies take turns using a vibrator on themselves) and cums on both of their faces. And sexy Hannah West dominates Heather Gables in a scene that includes the girls rimming each other's asshole, facesitti 5 1 2009-08-26 Mature Adult Notitsfuckingladiesfinallyguyswilddoublesuckanalblondemouthslutcamerabuttkissbrunettestyletoysnaturalfuckscutefingerincludesfacesittingbitchescleanlipssmokingcumsassholefaces,fingers,cunt,vibrator,sexually,pair http://www.iphods.com/movie/489/office-sluts/ http://www.iphods.com/videos/931514739d6b004642b4f4ac93266f18.m4v http://www.iphods.com/clips/thumbs/931514739d6b004642b4f4ac93266f18.jpg Office Sluts These horny babes spend all day talking about their office sex fantasies. They get so turned on they are compelled to turn their fantasies into reality. Beautiful girls sucking their boss's cock in his office, reception, and everywhere else. Double penetration on a desk girls' tongues fucking girls' pussies, two-girl-one-guy group sex and girls covered in cum! 3 1 2009-08-26 Mature Adult Nogirlscockgirlfuckingsuckingdoublesuckpussiestonguegroupofficecoveredfantasiesbosspenetration http://www.iphods.com/movie/489/office-sluts/ http://www.iphods.com/videos/074e9ee7510e1b9256f93a236d0e32e7.m4v http://www.iphods.com/clips/thumbs/074e9ee7510e1b9256f93a236d0e32e7.jpg Office Sluts These horny babes spend all day talking about their office sex fantasies. They get so turned on they are compelled to turn their fantasies into reality. Beautiful girls sucking their boss's cock in his office, reception, and everywhere else. Double penetration on a desk girls' tongues fucking girls' pussies, two-girl-one-guy group sex and girls covered in cum! 5 1 2009-08-26 Mature Adult Nogirlscockgirlfuckingsuckingdoublesuckpussiestonguegroupofficecoveredfantasiesbosspenetration http://www.iphods.com/movie/489/office-sluts/ http://www.iphods.com/videos/f9c14c160be14df872eda58378b5e789.m4v http://www.iphods.com/clips/thumbs/f9c14c160be14df872eda58378b5e789.jpg Office Sluts These horny babes spend all day talking about their office sex fantasies. They get so turned on they are compelled to turn their fantasies into reality. Beautiful girls sucking their boss's cock in his office, reception, and everywhere else. Double penetration on a desk girls' tongues fucking girls' pussies, two-girl-one-guy group sex and girls covered in cum! 2 1 2009-08-26 Mature Adult Nogirlscockgirlfuckingsuckingdoublesuckpussiestonguegroupofficecoveredfantasiesbosspenetration http://www.iphods.com/movie/490/sunny-lane-anal/ http://www.iphods.com/videos/cfc490789ff505f06105c4d26db56bb9.m4v http://www.iphods.com/clips/thumbs/cfc490789ff505f06105c4d26db56bb9.jpg Sunny Lane Anal 2009 AVN Award Winner for Best Anal Scene and 2009 AVN Award Winner for Best Big Butt ReleaseBig Wet Asses, the winner of AVN's coveted Best Anal Themed Series award for 2006, 2007, and 2008, is back! Elegant Angel is delighted to announce that porn superstar, Sunny Lane, stars in the thirteenth edition of the critically acclaimed series, performing in her very first, highly anticipated anal scene, alongside another stellar assemblage of voluptuous superstars. The curvaceous and fair-haired beauty, Sunny, performs with former AVN, male performer of the year, Manuel Ferrara. The scene is thirty five minutes of scorching hot, passionate sex, featuring plenty of balls to the wall, hardcore anal. The on set chemistry between Sunny and Manuel is electric. "I'm so happy," said Sunny. "It was such a great scene, and I was so excited and turned on. This scene was all I could think about last night. I had definitely been practicing over the past couple of weeks while thinking about Manuel's big cock penetrating my ass 2.5 1 2009-08-25 Mature Adult Nogirlsballsanalhardcoreorgasmorgasmspornwhitebuttnightkellyhighawardwinnerangelhaircallreleasehappyavn awardasseselegant angelpassionatehardcore analcouplesuperstarmaleballvoluptuousaward winner http://www.iphods.com/movie/491/fuck-rooms-volume-2/ http://www.iphods.com/videos/1fb0e154d11c7e520416ef63736132b4.m4v http://www.iphods.com/clips/thumbs/1fb0e154d11c7e520416ef63736132b4.jpg Fuck Rooms Volume 2 A Lucky Wreak Titus car is broken in a remote zone without a mobile phone. But he can reach the villa at the end of the street and ask for a phone. He knock at the door and Jasmine let him in to call a breakdown van. But he hope they delay so Jasmine asks him to fuck deeply in her beautiful ass, using asshole as well as her mouth. Date With A Red Car Bob has a date under the white moon with the girl met at the restaurant. Het gets out of his bright red sports car with a champagne bottle to drink for the fleeting date. When he watch Emili coing donw the long stairs of the square, hope that she doesn't wear panties. Get Hotter Inside Leanna invited Carlo for a drink in her home, but she offered him much more! She decided to be fucked as she didn't do from a long time giving him all the passion of her vagina. Finally because he was dreaming this moment for long time. Wild blowjobs and deep fucks as Leanna wants you to enjoy this moment! Bouncing Bed Angelica and Thomas rent a room in a nice charmin 5 1 2009-08-21 Mature Adult Nonicefinallywilddoeswhitemouthdoorblowjobsfuckstrainingsecretangelhottercallpantiesassholeloverslovercoupledecidewhen hephonelucky http://www.iphods.com/movie/491/fuck-rooms-volume-2/ http://www.iphods.com/videos/5506167e00850549dca622d20d931206.m4v http://www.iphods.com/clips/thumbs/5506167e00850549dca622d20d931206.jpg Fuck Rooms Volume 2 A Lucky Wreak Titus car is broken in a remote zone without a mobile phone. But he can reach the villa at the end of the street and ask for a phone. He knock at the door and Jasmine let him in to call a breakdown van. But he hope they delay so Jasmine asks him to fuck deeply in her beautiful ass, using asshole as well as her mouth. Date With A Red Car Bob has a date under the white moon with the girl met at the restaurant. Het gets out of his bright red sports car with a champagne bottle to drink for the fleeting date. When he watch Emili coing donw the long stairs of the square, hope that she doesn't wear panties. Get Hotter Inside Leanna invited Carlo for a drink in her home, but she offered him much more! She decided to be fucked as she didn't do from a long time giving him all the passion of her vagina. Finally because he was dreaming this moment for long time. Wild blowjobs and deep fucks as Leanna wants you to enjoy this moment! Bouncing Bed Angelica and Thomas rent a room in a nice charmin 5 1 2009-08-21 Mature Adult Nonicefinallywilddoeswhitemouthdoorblowjobsfuckstrainingsecretangelhottercallpantiesassholeloverslovercoupledecidewhen hephonelucky http://www.iphods.com/movie/492/busty-alexis-silver-36g/ http://www.iphods.com/videos/11957b5b804e82c45c09d6760df7e82d.m4v http://www.iphods.com/clips/thumbs/11957b5b804e82c45c09d6760df7e82d.jpg Busty Alexis Silver 36G Direct from our studio in California, CUMS our first volume of Alexis Silver, our busty slut with 36 G's. She is another young and busty, super horny babe just for you! Sit back and relax as our new honey entertain you. Watch Alexis Silver's best sex scenes ever... including her first hardcore anal scene ever recorded! 2.5 1 2009-08-21 Mature Adult Noyounghornyhardcorecumsbustyhardcore analsex scene http://www.iphods.com/movie/493/fiona-cooper-23-louise-hodges-michelle-thorne-jill/ http://www.iphods.com/videos/5d852562791dfd708190731a0133c7b4.m4v http://www.iphods.com/clips/thumbs/5d852562791dfd708190731a0133c7b4.jpg Fiona Cooper 23 - Louise Hodges, Michelle Thorne and Jill Louise Hodges: Everyone's favorite woman, Louise, is back to show you just how versatile she is! Wherever you want her, she's your girl! Tops, minis, thongs, hold-ups, tits, dressing gown, stockings and suspenders, finger-fun, suit, tights, toys, maids uniform, anal play, and sounds. Michelle Thorne: Well known in the adult broadcasting world, Michelle is about as hot as they come. Tops, great legs, delicious tits, shaven pussy, crotchless tights, thongs, multi-finger fun, anal play, toys, school uniform, knee socks, panties, stockings, and sounds. Jill: An older girl, meaning more experience and more fun! Suit, tops, slip, stockings, school uniform, panties, dressing gown, mini-dress, long dress, finger fun, lotion, thongs, and toys! 5 1 2009-08-21 Mature Adult Nopussytitsschoolexperiencewomanveryanalplaylegshelltoyscrotchfavoriteoldermichelleadultpantiesstockings http://www.iphods.com/movie/493/fiona-cooper-23-louise-hodges-michelle-thorne-jill/ http://www.iphods.com/videos/a0992445bab422354359aa2fc0f97f6c.m4v http://www.iphods.com/clips/thumbs/a0992445bab422354359aa2fc0f97f6c.jpg Fiona Cooper 23 - Louise Hodges, Michelle Thorne and Jill Louise Hodges: Everyone's favorite woman, Louise, is back to show you just how versatile she is! Wherever you want her, she's your girl! Tops, minis, thongs, hold-ups, tits, dressing gown, stockings and suspenders, finger-fun, suit, tights, toys, maids uniform, anal play, and sounds. Michelle Thorne: Well known in the adult broadcasting world, Michelle is about as hot as they come. Tops, great legs, delicious tits, shaven pussy, crotchless tights, thongs, multi-finger fun, anal play, toys, school uniform, knee socks, panties, stockings, and sounds. Jill: An older girl, meaning more experience and more fun! Suit, tops, slip, stockings, school uniform, panties, dressing gown, mini-dress, long dress, finger fun, lotion, thongs, and toys! 5 1 2009-08-21 Mature Adult Nopussytitsschoolexperiencewomanveryanalplaylegshelltoyscrotchfavoriteoldermichelleadultpantiesstockings http://www.iphods.com/movie/494/daddys-little-princess-4/ http://www.iphods.com/videos/7248ab79659b8ea8b85c1145e115cd2b.m4v http://www.iphods.com/clips/thumbs/7248ab79659b8ea8b85c1145e115cd2b.jpg Daddy's Little Princess 4 Daddy's little princes is all grown up, and she likes to fuck. She is spreading their legs and get it in every hole you want to put it in, and if you wanna bring you buddy then you are more than welocome he can have one hole while you pound the other. 2 1 2009-08-21 Mature Adult Nolegsspread http://www.iphods.com/movie/498/goddess-alexia-party-time-foot-preparation/ http://www.iphods.com/videos/eae9f9b24bdae966847e220620f318c8.m4v http://www.iphods.com/clips/thumbs/eae9f9b24bdae966847e220620f318c8.jpg Goddess Alexia - Party Time Foot Preparation Do you think you can handle the cruelty of Mistress Alexia? Watch as Mistress Alexia prepares herself for a fun evening out on the town. But guess what? Her pathetic slave isn't allowed to come along. Of course, Mistress Alexia makes him watch and envy her as she gets ready to leave, making him lay beneath her feet! 2.5 1 2009-08-21 Mature Adult Noslavemistressfeet http://www.iphods.com/movie/498/goddess-alexia-party-time-foot-preparation/ http://www.iphods.com/videos/72d1bc015537f617c37816e7b98a6b15.m4v http://www.iphods.com/clips/thumbs/72d1bc015537f617c37816e7b98a6b15.jpg Goddess Alexia - Party Time Foot Preparation Do you think you can handle the cruelty of Mistress Alexia? Watch as Mistress Alexia prepares herself for a fun evening out on the town. But guess what? Her pathetic slave isn't allowed to come along. Of course, Mistress Alexia makes him watch and envy her as she gets ready to leave, making him lay beneath her feet! 4 1 2009-08-21 Mature Adult Noslavemistressfeet http://www.iphods.com/movie/499/queens-of-trample/ http://www.iphods.com/videos/35aef3dd206a3159a3c21eb034529b5c.m4v http://www.iphods.com/clips/thumbs/35aef3dd206a3159a3c21eb034529b5c.jpg Queens Of Trample For the first time ever the MOST INTENSE, MOST BEAUTIFUL and MOST BRUTAL TRAMPLING MISTRESS are on one video. SIX VICIOUS VIXENS! TWELVE FEROCIOUS FEET in nonstop STOMPING ACTION! Shot during tapings of "Playboy Sexcetera" with SCOTT POTASNIK (host of the Playboy Sexcetera show), this video takes you both into the action and behind the scenes. The action begins with an incredible DOUBLE TRAMPLE of Slave Jonesy by the certifiably DEMENTED MISTRESS SANDRA ROMAINE and BIG TITTED BLONDE MISTRESS BARBARA SUMMERS. Their HIGH HEELS DIG DEEP into the slave's flesh as they stream VERBAL ABUSE. Then the ladies go solo. First Barbara takes her time crushing him and making him SUCK HER SPIKED HEEL, then Sandra goes to town, jumping on Jonsey and actually JOGGING ON HIM! Scott is encouraged to see how it feels to be trampled. BIG MISTAKE! Sandra and Barbara make him scream and leave him with a lasting and painful impression! Sandra and Barbara then team up again to TRAMPLE Slave Tom. He thinks he's a tough guy, but 2 1 2009-08-21 Mature Adult Nobeautifulpainslaveladiesbodymistressdeepdoublevideoplayblondefeetbehindintensehighhugejoinbarecreamskinfirst timepoormistressesshoesslavesheelsfloorincredible http://www.iphods.com/movie/499/queens-of-trample/ http://www.iphods.com/videos/7044266b901eacaf3af9a779d97f4ea5.m4v http://www.iphods.com/clips/thumbs/7044266b901eacaf3af9a779d97f4ea5.jpg Queens Of Trample For the first time ever the MOST INTENSE, MOST BEAUTIFUL and MOST BRUTAL TRAMPLING MISTRESS are on one video. SIX VICIOUS VIXENS! TWELVE FEROCIOUS FEET in nonstop STOMPING ACTION! Shot during tapings of "Playboy Sexcetera" with SCOTT POTASNIK (host of the Playboy Sexcetera show), this video takes you both into the action and behind the scenes. The action begins with an incredible DOUBLE TRAMPLE of Slave Jonesy by the certifiably DEMENTED MISTRESS SANDRA ROMAINE and BIG TITTED BLONDE MISTRESS BARBARA SUMMERS. Their HIGH HEELS DIG DEEP into the slave's flesh as they stream VERBAL ABUSE. Then the ladies go solo. First Barbara takes her time crushing him and making him SUCK HER SPIKED HEEL, then Sandra goes to town, jumping on Jonsey and actually JOGGING ON HIM! Scott is encouraged to see how it feels to be trampled. BIG MISTAKE! Sandra and Barbara make him scream and leave him with a lasting and painful impression! Sandra and Barbara then team up again to TRAMPLE Slave Tom. He thinks he's a tough guy, but 4 1 2009-08-21 Mature Adult Nobeautifulpainslaveladiesbodymistressdeepdoublevideoplayblondefeetbehindintensehighhugejoinbarecreamskinfirst timepoormistressesshoesslavesheelsfloorincredible http://www.iphods.com/movie/500/tickle-treat-smell-my-feet/ http://www.iphods.com/videos/6cd279f0337dda2e1039f66a1a470f0c.m4v http://www.iphods.com/clips/thumbs/6cd279f0337dda2e1039f66a1a470f0c.jpg Tickle Treat Smell My Feet Little johhny made a tremendous mistake when he was given money by Mistress Morgana and Mistress Anastasia to buy shoes. Instead, johhny went to Victorias Secret and bought something for himself. After a 'discovery' and some intense verbal discipline from Mistress Morgana, he is soundly spanked with a skanky slipper and forced to study Mistress Anastasia's feet. The Ladies then make him strip, and 'model' the nasty 'used' shoes he bought at Goodwill. They decide a tickle punishment bondage regimen is in order, along with some foot smothering/sniffing at the end. The slave is placed in 3 very effective bondage positions, rendering his strategic anatomy completely helpless for the Ladies' tickle torture. Tight ropes, and large scale custom built bondage furniture. A complete mummification in saran wrap and duct tape finds our victim enduring forced foot/shoe worship and black stocking covered foot smothering, while the other Mistress mercilessly tickles his feet with her long nails and he cannot move an inch! 4 1 2009-08-21 Mature Adult Nobondagepunishmentslaveladiesnastymistressforcedveryblackfeetfoottorturespankedintensetickleropesecretusedcoveredpositionssmotheringshoescompletelyhelplessdecidecompletepositionlargewhen he http://www.iphods.com/movie/501/bisex-party-vol-2-the-swingers-club/ http://www.iphods.com/videos/6673d436bca38505fe237787ad0320d5.m4v http://www.iphods.com/clips/thumbs/6673d436bca38505fe237787ad0320d5.jpg BiSex Party Vol. 2 - The Swingers Club The leading MMF studio in the world, Eromaxx, presents another bisexual tornado of cock and cunt that will leave you shaking in the knees. Dozens upon dozens of good looking guys and girls get it on in every conceivable way with whomever they want! ANYTHING goes with this wild and horny hoard of hotties that are down to fuck, suck, eat, rim, and shoot some hot loads of cum on whoever comes their way! There's so much insane bisex action jam-packed into this two-hour film that even after you've seen it, you still won't believe it! 2.5 1 2009-08-21 Mature Adult Nohornysexualfilmguyswildevenanythingbisexualhottiescuntshootknees http://www.iphods.com/movie/501/bisex-party-vol-2-the-swingers-club/ http://www.iphods.com/videos/14f5f7656254c3d2175f8650eeeda597.m4v http://www.iphods.com/clips/thumbs/14f5f7656254c3d2175f8650eeeda597.jpg BiSex Party Vol. 2 - The Swingers Club The leading MMF studio in the world, Eromaxx, presents another bisexual tornado of cock and cunt that will leave you shaking in the knees. Dozens upon dozens of good looking guys and girls get it on in every conceivable way with whomever they want! ANYTHING goes with this wild and horny hoard of hotties that are down to fuck, suck, eat, rim, and shoot some hot loads of cum on whoever comes their way! There's so much insane bisex action jam-packed into this two-hour film that even after you've seen it, you still won't believe it! 4.5 1 2009-08-21 Mature Adult Nohornysexualfilmguyswildevenanythingbisexualhottiescuntshootknees http://www.iphods.com/movie/502/naked-olympics/ http://www.iphods.com/videos/f0b6c0112af0105eeb77dea449878e69.m4v http://www.iphods.com/clips/thumbs/f0b6c0112af0105eeb77dea449878e69.jpg naked olympics Visit the most prestigious all girl track and field university - the hottest students while training for the Olympics engage in the wettest sex ever. The La Perla Lingerie come off and these girls become wilder than they could ever be at home. They are so horny and the boys and soviet spies sneak in at all hours and the girls greet them with open cunt holes and hold penises in their fragile hands and mouths and help to insert them into each others virgin anuses and pussy tunnels - some times the whole huge beautiful super model all girl team lines up to each taste a new cock - sexual tortures for team secrets, trembling anal devirginizations - the girls use the cum for new powers and eat and strangle on each semen snow wad. The hottest babes you will ever see. A remarkable collectors edition. Go for the gold if not then go for the pussy! Lil women rule! 4 1 2009-08-21 Mature Adult Nopussygirlbeautifulhandshottesthornywomenwildanalmouthboystortureholeshugetrainingsecretmouthscuntlingeriepower http://www.iphods.com/movie/548/oil-overload-disc-1/ http://www.iphods.com/videos/522ce2d6bb7a3254979993b7be7787a3.m4v http://www.iphods.com/clips/thumbs/522ce2d6bb7a3254979993b7be7787a3.jpg Oil Overload (Disc 1) 2009 AVN Award Nominee for Best Director Non-Feature and Best Gonzo ReleaseSuperstars lubed and cum-hungry for an overload of throbbing cocks! These slippery sluts are sliding all over the place getting ready to be fried in a batch of cum! Without a need for KY they can slide into anyone of their waiting holes and hungry faces. These girls love a messy fuck!! 4.5 1 2009-08-01 Mature Adult Nogirlslovegirlslutscocksslutholesnomineeawardreleaseavn awardaward nomineedirectorfacesfeaturesuperstarbest director http://www.iphods.com/movie/504/olympic-fever/ http://www.iphods.com/videos/483182a857d8d894e1b2f56e11ffa698.m4v http://www.iphods.com/clips/thumbs/483182a857d8d894e1b2f56e11ffa698.jpg Olympic Fever The Olympics like you've never seen them before! Kristin Powers is a struggling swimmer hoping to make the U.S. Swim Team. She has a protein deficiency which prevents her from obtaining her dream of winning gold medals. Kristin sees a doctor who prescribes her a dosage of protein in the form of sperm. Kristin's swimming times improve rapidly. 2 1 2009-08-19 Mature Adult Noevenkrispower http://www.iphods.com/movie/505/carnal-olympics/ http://www.iphods.com/videos/47950d3eeebe3a4d3d40731df4f940f7.m4v http://www.iphods.com/clips/thumbs/47950d3eeebe3a4d3d40731df4f940f7.jpg Carnal Olympics The unrivaled indoor sports An X-rated magazine sponsored a contest to determine who's the sexiest girl in San Francisco. After an exhaustive and deep probing search, an ace reporter sniffs out two sizzling strumpets who'll do anything for the $20,000 prize money in a no-holds-barred Carnal Olympics. Event number one finds each team in a very hot girl-girl love making event where the judges give the gals a ten on technique alone. Event number two has each girl seducing an officer of the law in a hard-driving shoot out of a very personal nature. In the final and decisive event number three, a not-to-be-believed pool party turns into an orgy of truly Olympian proportions where everyone turns out to be a wild, wild winner. 2.5 1 2009-08-18 Mature Adult Nogirlpartywildevenanythingthreewinnerofficealonesexiestpoolorgyshoottruly http://www.iphods.com/movie/508/buttlicking-whores-1/ http://www.iphods.com/videos/005d716d4a507ea680e651f02179abaa.m4v http://www.iphods.com/clips/thumbs/005d716d4a507ea680e651f02179abaa.jpg Buttlicking Whores 1 : Eating ass is just like eating pussy, except its ass. Six unsuspecting porn amateurs open wide for the big black cock and get a crash course in tossing salad. Cock, balls, hairy black man-ass and even feet are all on the menu for these hungry amateurs. These first time ass eating sluts are shy at first but then dig right in. All interracial, all amateur, all totally fuckin' freaky. 2.5 1 2009-08-15 Mature Adult Noballsevenblackslutsfeetslutamateurfirst timebig blackinterracialballunsuspecting http://www.iphods.com/movie/508/buttlicking-whores-1/ http://www.iphods.com/videos/e741da6f4542034a34ef4174a7c8a480.m4v http://www.iphods.com/clips/thumbs/e741da6f4542034a34ef4174a7c8a480.jpg Buttlicking Whores 1 : Eating ass is just like eating pussy, except its ass. Six unsuspecting porn amateurs open wide for the big black cock and get a crash course in tossing salad. Cock, balls, hairy black man-ass and even feet are all on the menu for these hungry amateurs. These first time ass eating sluts are shy at first but then dig right in. All interracial, all amateur, all totally fuckin' freaky. 4 1 2009-08-15 Mature Adult Noballsevenblackslutsfeetslutamateurfirst timebig blackinterracialballunsuspecting http://www.iphods.com/movie/508/buttlicking-whores-1/ http://www.iphods.com/videos/d4ce9377ce7a783abe0febd4bd8c05ec.m4v http://www.iphods.com/clips/thumbs/d4ce9377ce7a783abe0febd4bd8c05ec.jpg Buttlicking Whores 1 : Eating ass is just like eating pussy, except its ass. Six unsuspecting porn amateurs open wide for the big black cock and get a crash course in tossing salad. Cock, balls, hairy black man-ass and even feet are all on the menu for these hungry amateurs. These first time ass eating sluts are shy at first but then dig right in. All interracial, all amateur, all totally fuckin' freaky. 4.5 1 2009-08-15 Mature Adult Noballsevenblackslutsfeetslutamateurfirst timebig blackinterracialballunsuspecting http://www.iphods.com/movie/513/monsters-of-she-male-cock-5/ http://www.iphods.com/videos/edfd7d8d23a3da57de1e9d902abf0a59.m4v http://www.iphods.com/clips/thumbs/edfd7d8d23a3da57de1e9d902abf0a59.jpg Monsters Of She Male Cock 5 Bigger is better, everybody knows that, but what happens when you have to deal with huge! As in Monsters? Well, if youre talking about SheMales, monsters are fucking swesome. Just check out these heavy hung chicks to see what being built really means. Imagine trying to stretch your mouth over one of these trobbing cocks. And then think how it wold feel up your ass! Ouch, that's big! 4 1 2009-08-14 Mature Adult Nofuckingbodyverycockschickshugeheavyshemalesmalemonster http://www.iphods.com/movie/515/the-china-cat/ http://www.iphods.com/videos/227cb0ddcc760236b645e9026f2918bc.m4v http://www.iphods.com/clips/thumbs/227cb0ddcc760236b645e9026f2918bc.jpg The China Cat A retro, campy, spy-spoof follows the adventures of private- (and huge) dick, Johnny Wadd, played by the legendary John C. Holmes. Assigned a case via speakerphone a la Charlie's Angels, a sexy squad of female detectives goes undercover (and under covers!) trying to get their hands on a priceless jade statuette Wadd possesses. Fans of the mainstream film, Boogie Nights, will recognize scenes that were re-enacted for that movie, loosely based on Holmes real life. Shot entirely on film and directed by acclaimed director, Bob Chinn, this one is hot! 3.5 1 2009-08-14 Mature Adult Nosexyhandsfilmlifefemalenighthugeangeldirectormaleplayedcampphonefans http://www.iphods.com/movie/517/sex-usa/ http://www.iphods.com/videos/5bf79300fc6a1403f2bd0a2b1ebc1aad.m4v http://www.iphods.com/clips/thumbs/5bf79300fc6a1403f2bd0a2b1ebc1aad.jpg Sex U.S.A. Exploring the sex games of the nation! Suppose you were to glance out your window into the walled expanse of your private patio and discovered your neighbors having a little fuck-fest in grand style! Well that's what we're serving up! A private look at the lust and sexual feasts of your neighbors of this great country. Watch out for the nastiest and most erotic people who are playing out their fantasies of fucking and sucking their way into the sexual history of the USA. 2 1 2009-08-14 Mature Adult Nosexualstyleeroticcoveredgamesstoryfantasiesfest http://www.iphods.com/movie/518/tormented-bill-collector/ http://www.iphods.com/videos/99ce857a18e918851163272d0ccd8cc4.m4v http://www.iphods.com/clips/thumbs/99ce857a18e918851163272d0ccd8cc4.jpg Tormented Bill Collector Fed up with those annoying bill collectors? Let Mistress Aurora Storms put an end to that. Watch what she does to this helpless man and I'm sure you will reconsider other payment options and watch those depts disappear. Because if they aren't willing to give more time, she will scare those assholes straight! Messing with this Mistress is trouble and if you fuck with her you will pay the price 4.5 1 2009-08-14 Mature Adult Nomistressholesassholeswillingassholehelpless http://www.iphods.com/movie/518/tormented-bill-collector/ http://www.iphods.com/videos/8ff95a591cd98674c291aebe9fd7e001.m4v http://www.iphods.com/clips/thumbs/8ff95a591cd98674c291aebe9fd7e001.jpg Tormented Bill Collector Fed up with those annoying bill collectors? Let Mistress Aurora Storms put an end to that. Watch what she does to this helpless man and I'm sure you will reconsider other payment options and watch those depts disappear. Because if they aren't willing to give more time, she will scare those assholes straight! Messing with this Mistress is trouble and if you fuck with her you will pay the price 2 1 2009-08-14 Mature Adult Nomistressholesassholeswillingassholehelpless http://www.iphods.com/movie/519/san-francisco-lesbian-bondage-club-2/ http://www.iphods.com/videos/ba5d00f63c58283031fb0d968b5f9f7b.m4v http://www.iphods.com/clips/thumbs/ba5d00f63c58283031fb0d968b5f9f7b.jpg San Francisco Lesbian Bondage Club #2 Second in a series of Mistress Domination. Get ready for some tight nipple clipping and flogging ripe red butts are just some of the delightful punishments doled out by and to these bad babes. Toys and bondage center on women doing women who could ask for more? 2 1 2009-08-14 Mature Adult Nobondagepunishmentmistresswomenbutttoysseconddominationnipple http://www.iphods.com/movie/519/san-francisco-lesbian-bondage-club-2/ http://www.iphods.com/videos/a5bf5e09c816f9da8a896a974494e522.m4v http://www.iphods.com/clips/thumbs/a5bf5e09c816f9da8a896a974494e522.jpg San Francisco Lesbian Bondage Club #2 Second in a series of Mistress Domination. Get ready for some tight nipple clipping and flogging ripe red butts are just some of the delightful punishments doled out by and to these bad babes. Toys and bondage center on women doing women who could ask for more? 4.5 1 2009-08-14 Mature Adult Nobondagepunishmentmistresswomenbutttoysseconddominationnipple http://www.iphods.com/movie/520/bondage-selections-50/ http://www.iphods.com/videos/49d3f1dd46034d1315891b16fdc7f524.m4v http://www.iphods.com/clips/thumbs/49d3f1dd46034d1315891b16fdc7f524.jpg Bondage Selections #50 Our latest selection includes bits of "Sexual Bondage Play," "Automotive Binds" and "Master Liam's Bondage Slave." In "Sexual Bondage Play," Sindee has a secret liaison with her neighbor Goldie. When the husbands have left for work they meet to have a session of ties and teases. Ankles are confined and breasts are wound in soft but secure knots. Passion and pleasure collide this steamy afternoon. In "Automotive Binds," Dan has been outside repairing Marley's and Luccia's Jaguar, but they have a treat in mind for him. Instead of cash they want to pay him in bondage games. He's eager to treat these hot young women to an experience they won't forget. He knows more about ropes then most men... And finally in "Master Liam's Bondage Slave," Riley is dressed for action when Master Liam, enters the room and demands that she submit to being tied up. Suspended from the ceiling, plastic clothespins are placed in sensitive areas, and a rope gag muffles the sounds of pleasure and pain. Lifting her naked body across 3 1 2009-08-14 Mature Adult Nobondageslavebodyexperiencetiedmasterfinallysexualwomenorgasmropesecretsteamyeagerincludesgameshusbandminddungeonbreastsnakedclothestakenpair http://www.iphods.com/movie/521/body-builders-in-heat/ http://www.iphods.com/videos/bb088d7bcfcd2244d1c8dc2a5bd5864d.m4v http://www.iphods.com/clips/thumbs/bb088d7bcfcd2244d1c8dc2a5bd5864d.jpg Body Builders In Heat Watch these buff babes power fuck and suck! They pump iron all day and pump cock all night! See these buff beauties unleash the raw muscle and powerful pussy that will claim any man's cock! You better be prepared to give them what they want, or they might just body-slam you!! 5 1 2009-08-14 Mature Adult Nocockbodynightpumppower http://www.iphods.com/movie/523/maid-for-punishment/ http://www.iphods.com/videos/06cedf4feb4a97c7eb3deb4ba8a97526.m4v http://www.iphods.com/clips/thumbs/06cedf4feb4a97c7eb3deb4ba8a97526.jpg Maid For Punishment After inheriting millions of dollars, Jacqueline and Michael decide to hire a maid staff to care for their estate. Instead of ordinary housekeepers, they choose to offer $100,000 for young ladies who will submit to Jacqueline's sadistic desires. Jessica and Jennifer accept the offer because they need the money; Jasmine accepts the job in order to fulfill her lifelong desire to be a pleasure slave. This movie chronicles the first four months at the Estate in which you will witness all three young ladies punished far beyond their limits. Spankings that lead to tears and a bruised bottom are a daily occurrence. You will even get a peak behind closed doors, where Jacqueline explores the more sexual side of domination. 4.5 1 2009-08-14 Mature Adult Nospankingyoungladiessexualevenfourlifebottomthreebehinddoordominationclose100% http://www.iphods.com/movie/525/topless-bicycle-riders/ http://www.iphods.com/videos/25363e9c50f5b941688b03765553c052.m4v http://www.iphods.com/clips/thumbs/25363e9c50f5b941688b03765553c052.jpg topless bicycle riders Beautiful big-breasted babes bouncing on bicycles! It's another topless, hardcore extravaganza from director Stuart Canterbury. The stakes are high in the world's first topless bicycle race and the girls will do whatever it takes to win: Taking shortcuts across bumpy roads! Seducing their trainers! Hardcore anal sex! Watching these hardbodies streak through town and bounce down country roads will have you pumping all the way to the finish line! 4 1 2009-08-13 Mature Adult Noanalhighshortextradirectorpumphardcore anal http://www.iphods.com/movie/525/topless-bicycle-riders/ http://www.iphods.com/videos/c9c7251c1cf00523646ff57b202afac0.m4v http://www.iphods.com/clips/thumbs/c9c7251c1cf00523646ff57b202afac0.jpg topless bicycle riders Beautiful big-breasted babes bouncing on bicycles! It's another topless, hardcore extravaganza from director Stuart Canterbury. The stakes are high in the world's first topless bicycle race and the girls will do whatever it takes to win: Taking shortcuts across bumpy roads! Seducing their trainers! Hardcore anal sex! Watching these hardbodies streak through town and bounce down country roads will have you pumping all the way to the finish line! 5 1 2009-08-13 Mature Adult Noanalhighshortextradirectorpumphardcore anal http://www.iphods.com/movie/525/topless-bicycle-riders/ http://www.iphods.com/videos/be94d0d01cbfb389662f24b99d622475.m4v http://www.iphods.com/clips/thumbs/be94d0d01cbfb389662f24b99d622475.jpg topless bicycle riders Beautiful big-breasted babes bouncing on bicycles! It's another topless, hardcore extravaganza from director Stuart Canterbury. The stakes are high in the world's first topless bicycle race and the girls will do whatever it takes to win: Taking shortcuts across bumpy roads! Seducing their trainers! Hardcore anal sex! Watching these hardbodies streak through town and bounce down country roads will have you pumping all the way to the finish line! 4 1 2009-08-13 Mature Adult Noanalhighshortextradirectorpumphardcore anal http://www.iphods.com/movie/525/topless-bicycle-riders/ http://www.iphods.com/videos/f8ff1afa5e7701b09d7b3d2cf9a1b6d8.m4v http://www.iphods.com/clips/thumbs/f8ff1afa5e7701b09d7b3d2cf9a1b6d8.jpg topless bicycle riders Beautiful big-breasted babes bouncing on bicycles! It's another topless, hardcore extravaganza from director Stuart Canterbury. The stakes are high in the world's first topless bicycle race and the girls will do whatever it takes to win: Taking shortcuts across bumpy roads! Seducing their trainers! Hardcore anal sex! Watching these hardbodies streak through town and bounce down country roads will have you pumping all the way to the finish line! 5 1 2009-08-13 Mature Adult Noanalhighshortextradirectorpumphardcore anal http://www.iphods.com/movie/527/flower-squirt-shower-6/ http://www.iphods.com/videos/1b899bbec06098d58a233ee6ed616edd.m4v http://www.iphods.com/clips/thumbs/1b899bbec06098d58a233ee6ed616edd.jpg Flower Squirt Shower 6 2009 AVN Award Nominee for Best Squirting ReleaseThe AVN award winning series, Flower's Squirt Shower, returns with the sixth volume, starring the goddess of gush, porn super star Flower Tucci. Volume's 2 and 3 have both been recipient's of AVN editor's choice reviews, and at this year's AVN awards the series won for Best Specialty Release - Squirting. Squirt Shower 6 is bigger, better, and wetter than ever. Featuring a squirt drenched bevy of beautiful starlets including Jada Fire, Sindee Jennings, Britney Stevens, Nicki Hunter, and Gianna. While there are many imitators, Elegant Angel is the company that porn fans can rely upon for squirting movies that celebrate female orgasms with camera work that doesn't stay wide when you want it to get up close and intimate. Director William H.'s camera lens is once again squirt soaked, as Flower Tucci subjects us to a relentless onslaught of female ejaculation. 4.5 1 2009-08-12 Mature Adult Nobeautifulevenorgasmorgasmsporndoesfemalecameranomineeawardintimateangelsquirtingreleaseavn awardsquirtaward nomineedirectorelegant angelgoddessflowermalemoviesviewclosefans http://www.iphods.com/movie/528/sport-babes/ http://www.iphods.com/videos/faaf8226e8fa04b3809b3de58be885cd.m4v http://www.iphods.com/clips/thumbs/faaf8226e8fa04b3809b3de58be885cd.jpg Sport Babes Let their silken love muscles grab it! Practice is over. The high impact fuck sluts of SPORT BABES #3 are ready to show the world what they're made of! When push comes to shove, these hall-of-fame whores can take on any prick, no matter what the size. Their bodies are tight, toned fucking machines. They tackle cock with the ferocity of a linebacker and catch facials like outfielders. Show them man-meat and their silken love muscles will grab it, swallow it, and milk the slab dry. Every time these seasoned sexual athletes take on a stiff opponent, the pairing is a total blow out. Everybody sweats, everybody comes, and everybody wins! 4 1 2009-08-12 Mature Adult Nolovetightfuckingbodysexualslutssluthighwhoresblowpair http://www.iphods.com/movie/528/sport-babes/ http://www.iphods.com/videos/d77b571e9cef1690f0d15686a6187d98.m4v http://www.iphods.com/clips/thumbs/d77b571e9cef1690f0d15686a6187d98.jpg Sport Babes Let their silken love muscles grab it! Practice is over. The high impact fuck sluts of SPORT BABES #3 are ready to show the world what they're made of! When push comes to shove, these hall-of-fame whores can take on any prick, no matter what the size. Their bodies are tight, toned fucking machines. They tackle cock with the ferocity of a linebacker and catch facials like outfielders. Show them man-meat and their silken love muscles will grab it, swallow it, and milk the slab dry. Every time these seasoned sexual athletes take on a stiff opponent, the pairing is a total blow out. Everybody sweats, everybody comes, and everybody wins! 5 1 2009-08-12 Mature Adult Nolovetightfuckingbodysexualslutssluthighwhoresblowpair http://www.iphods.com/movie/529/squirting-201-vol-3/ http://www.iphods.com/videos/ea55588039d6721024489ce9dcd192dc.m4v http://www.iphods.com/clips/thumbs/ea55588039d6721024489ce9dcd192dc.jpg Squirting 201 Vol 3 Just when you thought it couldn't get more fun, more sexy, more outrageous, and more educational, Axel Braun once again tops himself and brings you another female ejaculation masterpiece! You will be shocked by seeing how much juice a woman can squirt. You will be amazed by learning how easy it is. And, ultimately, you'll become a believer! Get ready to get wet!!! 5 1 2009-08-11 Mature Adult Nomasterwomanfemalelearnsquirtmaleultimateshocked http://www.iphods.com/movie/530/pornolympics-the-anal-games/ http://www.iphods.com/videos/8aa68b82a4b4e1fb6807d11d43da78a9.m4v http://www.iphods.com/clips/thumbs/8aa68b82a4b4e1fb6807d11d43da78a9.jpg Pornolympics: The Anal Games 2009 AVN Award Nominee for Best Director Foreign Non-Feature and Best Foreign All Sex Release The important thing isn't to win but to FUCK! These are the horniest games ever! Includes orgies, DPs, lesbians, dildo and ass fucking with 22 sluts battling for gold in the world championship of fucking! This is definitely not the "Special Olympics"; it's the PORNOLYMPICS! The only Olympic games where everyone walks away with a "PRIZE," including the pretty Asian commentator. She took home a "gold star" for being a good sport in the bukkake game! 2.5 1 2009-08-11 Mature Adult Nolesbianfuckingveryslutsprettypornlesbiansslutdildonomineeawardasianincludesgamesreleaseavn awardaward nomineedirectorfeaturebest director http://www.iphods.com/movie/530/pornolympics-the-anal-games/ http://www.iphods.com/videos/c493044f6ffb396637cc9aa5e98b11eb.m4v http://www.iphods.com/clips/thumbs/c493044f6ffb396637cc9aa5e98b11eb.jpg Pornolympics: The Anal Games 2009 AVN Award Nominee for Best Director Foreign Non-Feature and Best Foreign All Sex Release The important thing isn't to win but to FUCK! These are the horniest games ever! Includes orgies, DPs, lesbians, dildo and ass fucking with 22 sluts battling for gold in the world championship of fucking! This is definitely not the "Special Olympics"; it's the PORNOLYMPICS! The only Olympic games where everyone walks away with a "PRIZE," including the pretty Asian commentator. She took home a "gold star" for being a good sport in the bukkake game! 2 1 2009-08-11 Mature Adult Nolesbianfuckingveryslutsprettypornlesbiansslutdildonomineeawardasianincludesgamesreleaseavn awardaward nomineedirectorfeaturebest director http://www.iphods.com/movie/533/insatiable-lesbians-4/ http://www.iphods.com/videos/33d542aa66152bb91ff6130fde7295c7.m4v http://www.iphods.com/clips/thumbs/33d542aa66152bb91ff6130fde7295c7.jpg Insatiable Lesbians 4 With just a little bit of lip, you will have her at your mercy....A woman's touch is all these girls need to explode in waves of orgasmic delight. Watch as these gorgeous women take control, and bring their partners to the brink of ecstasy. These women sure know just how to please each other! 4 1 2009-08-08 Mature Adult Nogirlwomenwomanorgasmpartner http://www.iphods.com/movie/533/insatiable-lesbians-4/ http://www.iphods.com/videos/9c4245dd665960974d7a27e39eb959e5.m4v http://www.iphods.com/clips/thumbs/9c4245dd665960974d7a27e39eb959e5.jpg Insatiable Lesbians 4 With just a little bit of lip, you will have her at your mercy....A woman's touch is all these girls need to explode in waves of orgasmic delight. Watch as these gorgeous women take control, and bring their partners to the brink of ecstasy. These women sure know just how to please each other! 4.5 1 2009-08-08 Mature Adult Nogirlwomenwomanorgasmpartner http://www.iphods.com/movie/534/bootylicious-lose-a-ho-gain-a-ho/ http://www.iphods.com/videos/4e2c6a76ee89f8f9fb7f5eda400be09a.m4v http://www.iphods.com/clips/thumbs/4e2c6a76ee89f8f9fb7f5eda400be09a.jpg Bootylicious: Lose A Ho', Gain A Ho' Stupid Ho's take big dick up their ass lockers, only to be thrown to the curb like the little trashy sluts that they truly are!! . DUMP DA BITCHES!! Like I always sez... LOSE A HO GAIN A HO, and it will all balance out in the end as long as your cock got stroked!!! 3 1 2009-08-08 Mature Adult Nodickslutsslutyour cockalwaysbitchestruly http://www.iphods.com/movie/535/milfs-gone-anal-vol-4/ http://www.iphods.com/videos/132ec1a76f1b097ab7baf6705d094618.m4v http://www.iphods.com/clips/thumbs/132ec1a76f1b097ab7baf6705d094618.jpg MILFS Gone Anal Vol. 4 Mama's taking it in the crack and she isn't ever coming back! Watch as some of our hottest MILFs turn into anal queens that just can't seem to get enough hard cock rammed in their ass! The Pink Visual crew is always obliged to help in a good ass fucking and we definitely like to take care of mama! 3 1 2009-08-08 Mature Adult Nofuckinghottestanalalwayshard cockmilfmilfsqueen http://www.iphods.com/movie/536/teenage-brotha-lovers-9/ http://www.iphods.com/videos/663526bb772120416fa4683d71e2abce.m4v http://www.iphods.com/clips/thumbs/663526bb772120416fa4683d71e2abce.jpg Teenage Brotha Lovers 9 Barely legal cuties, fresh out of high school, love that big black meat! They want to walk on the dark side and they get the toughest of meat... black meat! Full and ready to pound these little cuties until they explode all over there faces! It's all about the young chicks! 3 1 2009-08-08 Mature Adult Noloveschoolblackchickshighbaredarkchickfacesbig black http://www.iphods.com/movie/537/smoking-hot-in-nylons/ http://www.iphods.com/videos/e08e125afc1e29036c393bb5d46595fd.m4v http://www.iphods.com/clips/thumbs/e08e125afc1e29036c393bb5d46595fd.jpg Smoking Hot In Nylons It's erotic smoking and pantyhose play! Maxine x has brought along her friends and they are smoking... literally and playing with themselves for your erotic pleasure. Watch as they tempt and tease, undressing and touching, puffing and blowing you away! 2.5 1 2009-08-08 Mature Adult Nofriendseroticsmokingblowpantyhoseends http://www.iphods.com/movie/539/skateboard-kink-freak/ http://www.iphods.com/videos/0763293dbb7ef11c85ddb58c5bdee5a2.m4v http://www.iphods.com/clips/thumbs/0763293dbb7ef11c85ddb58c5bdee5a2.jpg Skateboard Kink Freak 2009 Feminist Porn Award Nominee.Michelle takes a very long break from her latest art installation to go and snatch the cutest petite female skateboardists from the playground down the block. Still wet behind the ears Amber is led blindfolded inside Michelle's loft space and with enthusiasm she very quickly transforms Amber into her latest "art piece" - Her Human Sextoy. Freaky Kinky and Hot.... Bondage, breast and pussy torture, anal, strap-on dildo penetration and deep throat, oral, kissing, spanking, whipping, masturbation, and a variety of kinky sex toys are a few of the lessons Amber will be taught today. Not to mention the "piece de resistance" ~ Skateboard Sex! 3 1 2009-08-08 Mature Adult Nopussyspankingbondagedeeppornkissingtorturekinkyfemalekissbehindhelldildonomineetoyscutewhippingwhiporalmichellefeministfeminist pornaward nomineemasturbationlessonmalepenetration http://www.iphods.com/movie/539/skateboard-kink-freak/ http://www.iphods.com/videos/9706e40a85e0d322ef9d618546dfc7be.m4v http://www.iphods.com/clips/thumbs/9706e40a85e0d322ef9d618546dfc7be.jpg Skateboard Kink Freak 2009 Feminist Porn Award Nominee.Michelle takes a very long break from her latest art installation to go and snatch the cutest petite female skateboardists from the playground down the block. Still wet behind the ears Amber is led blindfolded inside Michelle's loft space and with enthusiasm she very quickly transforms Amber into her latest "art piece" - Her Human Sextoy. Freaky Kinky and Hot.... Bondage, breast and pussy torture, anal, strap-on dildo penetration and deep throat, oral, kissing, spanking, whipping, masturbation, and a variety of kinky sex toys are a few of the lessons Amber will be taught today. Not to mention the "piece de resistance" ~ Skateboard Sex! 4 1 2009-08-08 Mature Adult Nopussyspankingbondagedeeppornkissingtorturekinkyfemalekissbehindhelldildonomineetoyscutewhippingwhiporalmichellefeministfeminist pornaward nomineemasturbationlessonmalepenetration http://www.iphods.com/movie/1408/briana-banks-more-lesbian-action/ http://www.iphods.com/videos/1999d74b4e51e0b81850a68703e0014e.m4v http://www.iphods.com/clips/thumbs/1999d74b4e51e0b81850a68703e0014e.jpg Briana Banks: More Lesbian Action Briana has a body anyone would die for...long, luscious legs, full round tits, and a tiny, tight ass that just begs for a reaming. Now you can see her beautiful body twist and bend in every position imaginable, in this collection of her award-winning sex scenes! Girl-on-girl, guy-on-girl, or just girl-on-herself, don't miss this breathtaking collection of the best scenes adult entertainment has to offer - especially with Briana Banks! 3 1 2005-04-22 Mature Adult Nogirltitsbeautifultightbodyverylegsawardespeciallyadultcollectiontight asssex sceneposition http://www.iphods.com/movie/544/nasty-nurses/ http://www.iphods.com/videos/6563650ee64767316f87d2f4e1b219d5.m4v http://www.iphods.com/clips/thumbs/6563650ee64767316f87d2f4e1b219d5.jpg Nasty Nurses Follow the doctor's orders. Stay in bed and get plenty of sex! In this erotic medical drama, you'll make the rounds with the world's hottest, horniest doctors and nurses as they treat themselves (and you) to a myriad of sexual delights. Even the patients get into the act. From a young motocross racer to a sexy male movie star, from interns and orderlies to candy stripers and more, all enjoy a healthy dose of sexual relief in a variety of clinical settings. NASTY NURSES is a thorough physical examination you're bound to enjoy! 2 1 2009-08-05 Mature Adult Nosexyboundnastyhottestsexualeveneroticmalenurse http://www.iphods.com/movie/544/nasty-nurses/ http://www.iphods.com/videos/0e33a44712977f25a6ab0baa868bc753.m4v http://www.iphods.com/clips/thumbs/0e33a44712977f25a6ab0baa868bc753.jpg Nasty Nurses Follow the doctor's orders. Stay in bed and get plenty of sex! In this erotic medical drama, you'll make the rounds with the world's hottest, horniest doctors and nurses as they treat themselves (and you) to a myriad of sexual delights. Even the patients get into the act. From a young motocross racer to a sexy male movie star, from interns and orderlies to candy stripers and more, all enjoy a healthy dose of sexual relief in a variety of clinical settings. NASTY NURSES is a thorough physical examination you're bound to enjoy! 3 1 2009-08-05 Mature Adult Nosexyboundnastyhottestsexualeveneroticmalenurse http://www.iphods.com/movie/545/insatiable/ http://www.iphods.com/videos/8e57dcf830db250ef8c0aed6ff17ecc4.m4v http://www.iphods.com/clips/thumbs/8e57dcf830db250ef8c0aed6ff17ecc4.jpg Insatiable AVN Top 500 Supermodel and heiress, Sandra Chase (Marilyn Chambers) quickly learns money can't buy happiness or satisfaction. While starring in her first movie, she finds herself caught in a wild web of sexual encounters with her co-stars. Insatiable also stars legendary John Holmes as Sandra's fantasy lover. Shot on location in rural America and cosmopolitan London, Insatiable will leave you hungry for more.. 2 1 2009-08-04 Mature Adult Nolovewildlearninsatiablefantasycaughtlover http://www.iphods.com/movie/547/all-up-in-her-grill-2-white-education/ http://www.iphods.com/videos/7f1ed74019f82fe2ee406af8e86b8499.m4v http://www.iphods.com/clips/thumbs/7f1ed74019f82fe2ee406af8e86b8499.jpg All Up In Her Grill 2 - White Education These white girls are getting their grills all messed up with cum all over them. They are taking black dicks like champs. One after another gets her pussy slammed and then they get cum all over their facesand in their mouths.Cum on their grillz! They want to wear their grillz while you fuck them! 3.5 1 2009-08-01 Mature Adult Nopussydickblackwhitemouthmouthsfacesdicks http://www.iphods.com/movie/549/she-male-a-go-go/ http://www.iphods.com/videos/149a4a643f2307ca2cd1eed371f0fdc7.m4v http://www.iphods.com/clips/thumbs/149a4a643f2307ca2cd1eed371f0fdc7.jpg She-Male A Go-Go Well, you wouldn't expect it, but that bulge in her panties is not a swollen mound of vaginal pleasure. Instead, it's a cock. She's, I mean uh, well, I don't know exactly what I mean, but this is a hot orgy and you're invited. Are you ready to get your swerve on? 3.5 1 2009-08-01 Mature Adult Nocockpleasurepantiesorgy http://www.iphods.com/movie/550/love-honor-obey/ http://www.iphods.com/videos/4b0dbd14183e2fe954cd58d80f5fa43a.m4v http://www.iphods.com/clips/thumbs/4b0dbd14183e2fe954cd58d80f5fa43a.jpg Love, Honor and Obey Imagine if Lucy and Ricky were really in the scene and played hard. That is what you have with our Lydia and John. This scenario includes domestic discipline only, unobscured by kisses, caresses, sex or any other mushy stuff. On a severity scale, it's a nine and three quarters. It also has superb picture and sound quality, one of the prettiest couples we've ever featured with some of the livliest dialog ever. Fantastic spanking action abounds! 5 1 2009-08-01 Mature Adult Nospankingboundkissincludescouplesfeaturedcouplefeatureplayed http://www.iphods.com/movie/551/femme-feet-1/ http://www.iphods.com/videos/a3e4d09299bd204d7346018772cf1699.m4v http://www.iphods.com/clips/thumbs/a3e4d09299bd204d7346018772cf1699.jpg Femme Feet 1 A foot worshipers dream cum true. These foot junkies love to have their feet tickled and tortured, they love it when smelly sweaty feet are rubbed across their faces, when they are trampled on with pointy spiked heels, and then finished off with a great blowjob! Yes, my friends, a foot junkies dream cum true!!!! 4 1 2009-08-01 Mature Adult Nolovefeettorturefriendstickleblowfacesheelsends http://www.iphods.com/movie/551/femme-feet-1/ http://www.iphods.com/videos/15525a2fd622758b1b17e87226ff49b3.m4v http://www.iphods.com/clips/thumbs/15525a2fd622758b1b17e87226ff49b3.jpg Femme Feet 1 A foot worshipers dream cum true. These foot junkies love to have their feet tickled and tortured, they love it when smelly sweaty feet are rubbed across their faces, when they are trampled on with pointy spiked heels, and then finished off with a great blowjob! Yes, my friends, a foot junkies dream cum true!!!! 3.5 1 2009-08-01 Mature Adult Nolovefeettorturefriendstickleblowfacesheelsends http://www.iphods.com/movie/552/next-door-bi-encounter-vol-1/ http://www.iphods.com/videos/e9c5331382ec4dd36fe70f222dbc7143.m4v http://www.iphods.com/clips/thumbs/e9c5331382ec4dd36fe70f222dbc7143.jpg Next Door: Bi-Encounter Vol. 1 This is the one you have been waiting for! Next Door Studios releases its VERY FIRST Bi-Sexual DVD! Oh and did we mention that everybody's favorite Tyler Cummings is one of the main stars! This is your chance to see Tyler Cummings play with another man's cock, as well as has have his cock sucked and jerked by other hot guys, while engaged in some of the hottest Bi-Sexual action we have ever got on film! Six steamy scenes - sexy threesomes and even a foursome. 4 1 2009-08-01 Mature Adult Nohottestbodyfilmguyssuckplayfourthreedoorsteamyfavoriterelease http://www.iphods.com/movie/553/tippin-tha-scales-2/ http://www.iphods.com/videos/a95d249361df11dc22e057d633aa1a1f.m4v http://www.iphods.com/clips/thumbs/a95d249361df11dc22e057d633aa1a1f.jpg Tippin' Tha Scales 2 These BBW's are taking big cocks to their limits! Don't miss this slightly overweight beautiful ladies getting real acquainted with a big fat cock!!! Pull up a seat and watch these "Big Boneded" bootylicious babes back that thang up. These hoochies got hips, dips and dick suckin lips...and they are ready to put it all out there for you! If you like big girls who know how to work it, then this is one movie you dont wanna miss! 2 1 2009-08-01 Mature Adult Noladiescocksbootylips http://www.iphods.com/movie/1408/briana-banks-more-lesbian-action/ http://www.iphods.com/videos/33f2560ad5da0b23a9427766c09614a3.m4v http://www.iphods.com/clips/thumbs/33f2560ad5da0b23a9427766c09614a3.jpg Briana Banks: More Lesbian Action Briana has a body anyone would die for...long, luscious legs, full round tits, and a tiny, tight ass that just begs for a reaming. Now you can see her beautiful body twist and bend in every position imaginable, in this collection of her award-winning sex scenes! Girl-on-girl, guy-on-girl, or just girl-on-herself, don't miss this breathtaking collection of the best scenes adult entertainment has to offer - especially with Briana Banks! 3.5 1 2005-04-22 Mature Adult Nogirltitsbeautifultightbodyverylegsawardespeciallyadultcollectiontight asssex sceneposition http://www.iphods.com/movie/1408/briana-banks-more-lesbian-action/ http://www.iphods.com/videos/4a9069e8f9792361c4501b3c47b07ae4.m4v http://www.iphods.com/clips/thumbs/4a9069e8f9792361c4501b3c47b07ae4.jpg Briana Banks: More Lesbian Action Briana has a body anyone would die for...long, luscious legs, full round tits, and a tiny, tight ass that just begs for a reaming. Now you can see her beautiful body twist and bend in every position imaginable, in this collection of her award-winning sex scenes! Girl-on-girl, guy-on-girl, or just girl-on-herself, don't miss this breathtaking collection of the best scenes adult entertainment has to offer - especially with Briana Banks! 3 1 2005-04-22 Mature Adult Nogirltitsbeautifultightbodyverylegsawardespeciallyadultcollectiontight asssex sceneposition http://www.iphods.com/movie/555/by-appointment-only-6/ http://www.iphods.com/videos/41889f57798ad1af6acfccde990327c6.m4v http://www.iphods.com/clips/thumbs/41889f57798ad1af6acfccde990327c6.jpg By Appointment Only #6 After a bit of tongue tutoring, Andie slowly licks her way to Jana's hot pussy. Photographer Justine hires Marie to pose for her. Things begin to sizzle when Justine drips candle wax on Marie's hot body. Roxy is eager to please her client Kim, starting with a sensuous foot massage! This is one appointment you don't wanna miss... We're Ready For You Now!!! 4.5 1 2009-07-30 Mature Adult Nopussyfoottongueeagerslowly http://www.iphods.com/movie/555/by-appointment-only-6/ http://www.iphods.com/videos/8abcdcb39b112519c06aa6607671c8ed.m4v http://www.iphods.com/clips/thumbs/8abcdcb39b112519c06aa6607671c8ed.jpg By Appointment Only #6 After a bit of tongue tutoring, Andie slowly licks her way to Jana's hot pussy. Photographer Justine hires Marie to pose for her. Things begin to sizzle when Justine drips candle wax on Marie's hot body. Roxy is eager to please her client Kim, starting with a sensuous foot massage! This is one appointment you don't wanna miss... We're Ready For You Now!!! 3 1 2009-07-30 Mature Adult Nopussyfoottongueeagerslowly http://www.iphods.com/movie/555/by-appointment-only-6/ http://www.iphods.com/videos/3ee9b80b12679cdf9bc022c7177c7a77.m4v http://www.iphods.com/clips/thumbs/3ee9b80b12679cdf9bc022c7177c7a77.jpg By Appointment Only #6 After a bit of tongue tutoring, Andie slowly licks her way to Jana's hot pussy. Photographer Justine hires Marie to pose for her. Things begin to sizzle when Justine drips candle wax on Marie's hot body. Roxy is eager to please her client Kim, starting with a sensuous foot massage! This is one appointment you don't wanna miss... We're Ready For You Now!!! 2 1 2009-07-30 Mature Adult Nopussyfoottongueeagerslowly http://www.iphods.com/movie/1408/briana-banks-more-lesbian-action/ http://www.iphods.com/videos/606c265e1409a337e2c68502ff7ff531.m4v http://www.iphods.com/clips/thumbs/606c265e1409a337e2c68502ff7ff531.jpg Briana Banks: More Lesbian Action Briana has a body anyone would die for...long, luscious legs, full round tits, and a tiny, tight ass that just begs for a reaming. Now you can see her beautiful body twist and bend in every position imaginable, in this collection of her award-winning sex scenes! Girl-on-girl, guy-on-girl, or just girl-on-herself, don't miss this breathtaking collection of the best scenes adult entertainment has to offer - especially with Briana Banks! 4 1 2005-04-22 Mature Adult Nogirltitsbeautifultightbodyverylegsawardespeciallyadultcollectiontight asssex sceneposition http://www.iphods.com/movie/557/more-cushion-for-the-pushin-2/ http://www.iphods.com/videos/d2a43c6c1170bf206d524098661453e1.m4v http://www.iphods.com/clips/thumbs/d2a43c6c1170bf206d524098661453e1.jpg More Cushion For The Pushin' #2 Cassandra loves sucking dick and smothering guys with her ample ass! We oiled up naughty new comer Noels voluptuous body before we let Nick go to town on that ass! Ally Foster is a pretty young thing from Indiana with a great set of 38D yabos! 19 year-old blonde hottie Oklahoma wants you to eat her pussy and then fuck her hard! Victoria Vonn is a passionate tramp from Florida who is always thirsty for hard cock. If all natural curvaceous sluts make you horny , they you'll love more cushion for the pushin' #2. 2.5 1 2009-07-29 Mature Adult Nocockpussyyoungdicksuckingbodyhornyguyssuckslutsprettyblondeslutlovesnaturalnaughtyalwayshard cocksmotheringpassionatevoluptuous http://www.iphods.com/movie/558/best-of-eden-38dd/ http://www.iphods.com/videos/9add629faf1a95fbfe3c6d9a5f885a56.m4v http://www.iphods.com/clips/thumbs/9add629faf1a95fbfe3c6d9a5f885a56.jpg Best Of Eden 38DD Eden is busty, beautiful, and bodacious! Watch all her best XXX fuck scenes right here on one DVD! Loaded with titty fuckin', ass poundin', and dick suckin' action! This is one BBW that will make you want to shoot your load all over the place! Her big titties are not to be undermined! 4 1 2009-07-28 Mature Adult Nodicksuckbustyshoot http://www.iphods.com/movie/559/redhead-realtor/ http://www.iphods.com/videos/8bd4308cb2b680b645af5cd9cf807537.m4v http://www.iphods.com/clips/thumbs/8bd4308cb2b680b645af5cd9cf807537.jpg Redhead Realtor This realtor is all about the customer! She gives a tour, lets you know about any plumbing problems, and then she starts talking closing costs...starting with sucking your huge hard cock. Then she rides it until you don't think you can take anymore! She's a full service professional, always leaving the customer satisfied. 3.5 1 2009-07-24 Mature Adult Nosuckingsuckridehugealwayshard cock http://www.iphods.com/movie/559/redhead-realtor/ http://www.iphods.com/videos/c2b47eadcd409bf8290de80be0544c63.m4v http://www.iphods.com/clips/thumbs/c2b47eadcd409bf8290de80be0544c63.jpg Redhead Realtor This realtor is all about the customer! She gives a tour, lets you know about any plumbing problems, and then she starts talking closing costs...starting with sucking your huge hard cock. Then she rides it until you don't think you can take anymore! She's a full service professional, always leaving the customer satisfied. 2.5 1 2009-07-24 Mature Adult Nosuckingsuckridehugealwayshard cock http://www.iphods.com/movie/560/its-a-daddy-thing-4/ http://www.iphods.com/videos/0dd6ee6b74c0be8523b1ff76aa691c6f.m4v http://www.iphods.com/clips/thumbs/0dd6ee6b74c0be8523b1ff76aa691c6f.jpg It's A Daddy Thing! 4 2009 AVN Award Winner for Best Young Girl Series.Patrick Collins returns with another collection of prissy, cock teasing teens in Elegant Angel's It's a Daddy Thing 4. Alexis Love, Evie Delatosso, Nika, Naomi Cruise, and Nikki Flame star as filthy young flirtatious sluts, provocatively seducing older guys. The movie is a sexually sophisticated depiction of fantasy role-playing at its best. Elegant Angel is the porn company that customers can rely upon for a more creative brand of eroticism. 5 1 2009-07-24 Mature Adult Nococklovegirlguysplayslutspornsluteroticawardwinnerangelolderteasingfantasyavn awardcollectionelegant angelcollinssexuallyaward winnerfilthy http://www.iphods.com/movie/561/taylor-wayne-smoking-mary-jane/ http://www.iphods.com/videos/7ce7cc071eb61bbc7144d2090bbee46c.m4v http://www.iphods.com/clips/thumbs/7ce7cc071eb61bbc7144d2090bbee46c.jpg Taylor Wayne Smoking Mary Jane Taylor and Smoking Mary Jane join loins and bring along their friends to give you an up close and personal view of how they please each other when cock is no where to be found. Finally a company that understands how important it is to cast women who really are into women to film a girl on girl movie. Filled with different fetishes from smoking to drooling, this girl/girl presentation is sure to give even the colonel s recipe a run for its money! These girls are all finger licking good! Bonus Footage Included 4 1 2009-07-24 Mature Adult Nogirlscockgirlfinallyfilmevenfootfetishfriendsfilledlickingfootagejoinfingersmokingbonusendsviewclose http://www.iphods.com/movie/562/ghetto-beach-2/ http://www.iphods.com/videos/9c41ad03eaa0fa9819d4a9c379aea2d8.m4v http://www.iphods.com/clips/thumbs/9c41ad03eaa0fa9819d4a9c379aea2d8.jpg Ghetto Beach #2 These girls want a break from the daily life of sucking and fucking their gangster boyfriends in the back seat of their cars. They need a change of scenery, so they go to the beaches in paradise to unleash their passionate lust and horny desires!! Watch the steamy action!! 4.5 1 2009-07-24 Mature Adult Nogirlsfuckingsuckinglifeboyfriendfriendssteamypassionate http://www.iphods.com/movie/563/bound-gagged-damsels-2/ http://www.iphods.com/videos/39f42971c6a425e8e363a936476353f6.m4v http://www.iphods.com/clips/thumbs/39f42971c6a425e8e363a936476353f6.jpg Bound and Gagged Damsels 2 Eight bondage tales with serious damsel action! Abduction! Ransom! Full nudity and fondling! Kidnappings with onscreen grabbing, tying, gagging and molesting -- this is a bondage film not to be missed if you are a diehard fan of damsel-in-distress action! Eight scenes, eleven hot models, 75 minutes! 4.5 1 2009-07-24 Mature Adult Nobondagefilm http://www.iphods.com/movie/567/evie-young-tight-latinas/ http://www.iphods.com/videos/3381b20192bc75bf4fb427236f1adc2d.m4v http://www.iphods.com/clips/thumbs/3381b20192bc75bf4fb427236f1adc2d.jpg Evie - Young Tight Latinas Think it gets hot where you are, well come down below the border with us and try some of the spicy dippin' we've got for you here! Warm, soft senoritas are just waiting to show you how ready they are to suck your big dick just to get themselves hot enough to sizzle. Then get ready for the searing; ball draining screwin' that only these sex starved Latin Honeys can give you. If you like it hot, really hot... you're on your way to a Latin sex fiesta with non-stop chiquita's doing their thing, and yours too! 5 1 2009-07-23 Mature Adult Nosuckball http://www.iphods.com/movie/567/evie-young-tight-latinas/ http://www.iphods.com/videos/f9f69c733547e5ce0c8aa5ee9bf57b96.m4v http://www.iphods.com/clips/thumbs/f9f69c733547e5ce0c8aa5ee9bf57b96.jpg Evie - Young Tight Latinas Think it gets hot where you are, well come down below the border with us and try some of the spicy dippin' we've got for you here! Warm, soft senoritas are just waiting to show you how ready they are to suck your big dick just to get themselves hot enough to sizzle. Then get ready for the searing; ball draining screwin' that only these sex starved Latin Honeys can give you. If you like it hot, really hot... you're on your way to a Latin sex fiesta with non-stop chiquita's doing their thing, and yours too! 2 1 2009-07-23 Mature Adult Nosuckball http://www.iphods.com/movie/567/evie-young-tight-latinas/ http://www.iphods.com/videos/3882064cf8f86b877a221c9cfd0d5779.m4v http://www.iphods.com/clips/thumbs/3882064cf8f86b877a221c9cfd0d5779.jpg Evie - Young Tight Latinas Think it gets hot where you are, well come down below the border with us and try some of the spicy dippin' we've got for you here! Warm, soft senoritas are just waiting to show you how ready they are to suck your big dick just to get themselves hot enough to sizzle. Then get ready for the searing; ball draining screwin' that only these sex starved Latin Honeys can give you. If you like it hot, really hot... you're on your way to a Latin sex fiesta with non-stop chiquita's doing their thing, and yours too! 2.5 1 2009-07-23 Mature Adult Nosuckball http://www.iphods.com/movie/569/faye-reagan-redhead-week/ http://www.iphods.com/videos/10d219b010811ab42509b8023daed981.m4v http://www.iphods.com/clips/thumbs/10d219b010811ab42509b8023daed981.jpg Faye Reagan - RedHead Week Young, dumb and covered in cum... That's the way we love 'em! Six fresh-faced teen whores are getting fucked, stuffed and gagged with cock right in front of our cameras for the very first time. Our horny guys are let loose on these cute little fuck sluts, and they drill their tight pink holes with rock hard dicks until they scream their lungs out! Then our teen tramps suck massive fuck tools until they get completely plastered in load after load of steaming hot cum, which they lick up like ice cream. You'll swear you're in teen twat heaven. 2 1 2009-07-22 Mature Adult Noloveyoungtightdickhornyguysveryslutsgaggedholeswhorescutecoveredmassivecreamrock hardfirst timedickscompletelycompletestuffed http://www.iphods.com/movie/571/spunkd-the-movie/ http://www.iphods.com/videos/1b7b31491738da7176455c54c0ee786b.m4v http://www.iphods.com/clips/thumbs/1b7b31491738da7176455c54c0ee786b.jpg Spunk'd The Movie One of the best porn parodies in recent memory, Nick Manning heads up this all-star porn cast parodying some of the biggest stars in Hollywood. Nick Manning plays Gashton Cootcher who "spunks" his celebrity friends by setting them up in outrageous sexual situations and then reveals the prank each time by "dropping loads" himself on the celebrity's face. Penny Flame convincingly plays "Lindsey Blowhan" getting a strip search and then a "full cavity search" from Wilmer Balled-Yer-Mama while a security guard provides some comedic commentary. One of the funnier parts of this scene comes from the dog. Next, Lexi Belle and Aurora Snow play "Cornhole Richie" and "Hairless Hilton" two rich primadonnas who get stuck staying with a horny, hillbilly family for their reality show.They proceed to get "home schooled" sex education classes from the back woods family. Kaiya Lynn, Katie Morgan and Steven St. Croix parody Grey's Anatomy. A "guest director" makes some script changes that have "Kathryn Hymen" and "Sand 3.5 1 2009-07-18 Mature Adult Nopussysexyhandsschooldickhornysexualevenplayporndoesboyfriendfriendsholesashleyangellearnhairsquirtinglipsblowsquirtdirectorasseslynnflowerjeremylessonendsballplayed,sisters,decide,table,truly,biggest,hollywood http://www.iphods.com/movie/572/the-return-of-teenage-christy-canyon/ http://www.iphods.com/videos/d1818cf6600041053c1a9af8a3d6f34f.m4v http://www.iphods.com/clips/thumbs/d1818cf6600041053c1a9af8a3d6f34f.jpg The Return Of Teenage Christy Canyon Few porn stars are as fresh, alluring and downright cock hardening as the young 18 and 19 year old Christy Canyon was when she began stopping hearts in her earliest porn performances. Just what the fuck were those HUGE tits doing on that leggy slender body? Why is a chick this HOT doing porno in the first place? Where did she get that endless sexual energy that made her so game to suck, fuck and satisfy? We attempt to answer these questions and more in this continuation of our HOTTEST collection series ever! Rare loops, titty fucking action, Christy as a dominatrix and more, all topped off with a gallery of rare early stills of the sexiest teenage-titty queen of all time! Rated XXX! 5 1 2009-07-18 Mature Adult Nocockyoungtitsfuckinghottestbodysuckpornhugesexiestcollectiondominatrixqueen http://www.iphods.com/movie/572/the-return-of-teenage-christy-canyon/ http://www.iphods.com/videos/4dba4944c35e7c5730510c734e6930de.m4v http://www.iphods.com/clips/thumbs/4dba4944c35e7c5730510c734e6930de.jpg The Return Of Teenage Christy Canyon Few porn stars are as fresh, alluring and downright cock hardening as the young 18 and 19 year old Christy Canyon was when she began stopping hearts in her earliest porn performances. Just what the fuck were those HUGE tits doing on that leggy slender body? Why is a chick this HOT doing porno in the first place? Where did she get that endless sexual energy that made her so game to suck, fuck and satisfy? We attempt to answer these questions and more in this continuation of our HOTTEST collection series ever! Rare loops, titty fucking action, Christy as a dominatrix and more, all topped off with a gallery of rare early stills of the sexiest teenage-titty queen of all time! Rated XXX! 3.5 1 2009-07-18 Mature Adult Nocockyoungtitsfuckinghottestbodysuckpornhugesexiestcollectiondominatrixqueen http://www.iphods.com/movie/572/the-return-of-teenage-christy-canyon/ http://www.iphods.com/videos/3f8e4849ac9e3633e0c16c661902d693.m4v http://www.iphods.com/clips/thumbs/3f8e4849ac9e3633e0c16c661902d693.jpg The Return Of Teenage Christy Canyon Few porn stars are as fresh, alluring and downright cock hardening as the young 18 and 19 year old Christy Canyon was when she began stopping hearts in her earliest porn performances. Just what the fuck were those HUGE tits doing on that leggy slender body? Why is a chick this HOT doing porno in the first place? Where did she get that endless sexual energy that made her so game to suck, fuck and satisfy? We attempt to answer these questions and more in this continuation of our HOTTEST collection series ever! Rare loops, titty fucking action, Christy as a dominatrix and more, all topped off with a gallery of rare early stills of the sexiest teenage-titty queen of all time! Rated XXX! 4 1 2009-07-18 Mature Adult Nocockyoungtitsfuckinghottestbodysuckpornhugesexiestcollectiondominatrixqueen http://www.iphods.com/movie/573/taboo-charming-mother-3-the-lust-cry/ http://www.iphods.com/videos/a29451a63a99cb0ae15ea40e52c95fd8.m4v http://www.iphods.com/clips/thumbs/a29451a63a99cb0ae15ea40e52c95fd8.jpg Taboo Charming Mother 3 - The Lust Cry Misako finds out that all of the pranks were the cause of Kazuhiko. She does her best to fight off, but it's already too late for her. she can no longer go back to an ordinary life. She is now Kazuhiko's slave for lust and passion. The wall of sanity is now torn down, but things are just getting heated up for the next level! There is no stopping now. Tsuzuru Miyabi Proudly Presents Taboo Charming Mother Volume 3, enjoy! 2.5 1 2009-07-18 Mature Adult Noslavedoeslife http://www.iphods.com/movie/574/mistreated-bride-vol-2/ http://www.iphods.com/videos/fb3af09314a5e4b33d2696c9d4c8f22c.m4v http://www.iphods.com/clips/thumbs/fb3af09314a5e4b33d2696c9d4c8f22c.jpg Mistreated Bride Vol. 2 Mitsuko now no longer lives the same like she has had in the past. Now her days are filled with forbidden lust with her stepfather and stepbrother that she craves for personally! But thats not the only secret that lies within the Takayanagi residence. Her stepfather's wife, Sumie is also involved in a dark and forbidden lust that no one has ever known about - or is it? The second installment of Mistreated Bride 2 is finally here!This movie is featured in the original Japanese without subtitles. 3.5 1 2009-07-17 Mature Adult Nofinallyfilledridesecretseconddarkwifejapanesefeaturedfeatureoriginal http://www.iphods.com/movie/575/taboo-charming-mother-vol-4-comparing-meat/ http://www.iphods.com/videos/7b1256a74b9cdeb29069b5977de43968.m4v http://www.iphods.com/clips/thumbs/7b1256a74b9cdeb29069b5977de43968.jpg Taboo Charming Mother Vol. 4 - Comparing Meat 2007 AVN Award Nominee for Best Animated Release.As each day passes by, Misako looses her sanity, now no longer feeling guilty about betraying her other half. What once was a sin is now a pleasure she can not live without. She thought her secret love affair would be kept under the dark but things take a big turn. What surprising actions will Kazuhiko take to fulfill his lust? How will Misako deal with it? You will be totally amazed and shocked with his 4th installment of the Taboo Charming Mother series.This movie is featured in the original Japanese with English subtitles. 2.5 1 2009-07-16 Mature Adult Nopleasureawardsecretdarkjapaneseavn awardaward nomineeassesfeaturedoriginalshocked http://www.iphods.com/movie/575/taboo-charming-mother-vol-4-comparing-meat/ http://www.iphods.com/videos/168cf8756f30116da566377a4863fda5.m4v http://www.iphods.com/clips/thumbs/168cf8756f30116da566377a4863fda5.jpg Taboo Charming Mother Vol. 4 - Comparing Meat 2007 AVN Award Nominee for Best Animated Release.As each day passes by, Misako looses her sanity, now no longer feeling guilty about betraying her other half. What once was a sin is now a pleasure she can not live without. She thought her secret love affair would be kept under the dark but things take a big turn. What surprising actions will Kazuhiko take to fulfill his lust? How will Misako deal with it? You will be totally amazed and shocked with his 4th installment of the Taboo Charming Mother series.This movie is featured in the original Japanese with English subtitles. 4 1 2009-07-16 Mature Adult Nopleasureawardsecretdarkjapaneseavn awardaward nomineeassesfeaturedoriginalshocked http://www.iphods.com/movie/575/taboo-charming-mother-vol-4-comparing-meat/ http://www.iphods.com/videos/0f4c63d6e806d87a5efc6813b6591bd7.m4v http://www.iphods.com/clips/thumbs/0f4c63d6e806d87a5efc6813b6591bd7.jpg Taboo Charming Mother Vol. 4 - Comparing Meat 2007 AVN Award Nominee for Best Animated Release.As each day passes by, Misako looses her sanity, now no longer feeling guilty about betraying her other half. What once was a sin is now a pleasure she can not live without. She thought her secret love affair would be kept under the dark but things take a big turn. What surprising actions will Kazuhiko take to fulfill his lust? How will Misako deal with it? You will be totally amazed and shocked with his 4th installment of the Taboo Charming Mother series.This movie is featured in the original Japanese with English subtitles. 3.5 1 2009-07-16 Mature Adult Nopleasureawardsecretdarkjapaneseavn awardaward nomineeassesfeaturedoriginalshocked http://www.iphods.com/movie/576/mean-bitches-erotic-femdom-2/ http://www.iphods.com/videos/ba256fa04b06940cbcbbbfaff528e2a2.m4v http://www.iphods.com/clips/thumbs/ba256fa04b06940cbcbbbfaff528e2a2.jpg Mean Bitches - Erotic FemDom 2 Do you belong at the feet of a beautiful woman? Are you ready to be hypnotized, enslaved, and used by a goddess? Are you helpless around the young cheerleaders who used to laugh at you when you were in college? Are you ready for some big-ass facesitting and smothering? If so, this is the dvd for you! This DVD features gorgeous women and their slaved with lots of ass worship, facesitting, foot worship and erotic female domination! Don't miss scene two with Nautica Thorn and Tommy Gunn playing superhero! It's hilarious, and you know with two of the best performers in adult, it's totally hot! 4.5 1 2009-07-16 Mature Adult Noyoungbeautifulslavewomenwomanplayfeetfootfemaleeroticusedfacesittingdominationadultfacessmotheringgoddessass worshipfeaturemalehelpless http://www.iphods.com/movie/577/ferocious/ http://www.iphods.com/videos/978ba96458fe3db334849b037d6523c1.m4v http://www.iphods.com/clips/thumbs/978ba96458fe3db334849b037d6523c1.jpg Ferocious! FEROCIOUS, the debut movie from enigmatic director Sancho, is pure supercharged thunder fucking at its most intense. With a cast of eight bewitching beauties, each savage scene breaks the boundary of anything you have ever seen from TeraVision before. The passionate ravaging between the beautiful and fiery Latinas Daisy and Paola Rey is only complimented by the commanding Jayme Langford and the animalistic and disturbing fornication of Madison Young. Experience the emotional depravity of Angie Savage as she is fiercely and forcibly taken and dealt with! 2.5 1 2009-07-16 Mature Adult Noyoungboundfuckingexperienceanythingintensedirectorpassionatetaken http://www.iphods.com/movie/577/ferocious/ http://www.iphods.com/videos/c83b24c645eca5d1aed5ac5d8639c73f.m4v http://www.iphods.com/clips/thumbs/c83b24c645eca5d1aed5ac5d8639c73f.jpg Ferocious! FEROCIOUS, the debut movie from enigmatic director Sancho, is pure supercharged thunder fucking at its most intense. With a cast of eight bewitching beauties, each savage scene breaks the boundary of anything you have ever seen from TeraVision before. The passionate ravaging between the beautiful and fiery Latinas Daisy and Paola Rey is only complimented by the commanding Jayme Langford and the animalistic and disturbing fornication of Madison Young. Experience the emotional depravity of Angie Savage as she is fiercely and forcibly taken and dealt with! 2.5 1 2009-07-16 Mature Adult Noyoungboundfuckingexperienceanythingintensedirectorpassionatetaken http://www.iphods.com/movie/578/moms-a-cheater-volume-3/ http://www.iphods.com/videos/83bbdaad689c67ff508d5b378b4bb6ba.m4v http://www.iphods.com/clips/thumbs/83bbdaad689c67ff508d5b378b4bb6ba.jpg Moms A Cheater Volume 3 You thought your best friend's mom was a goody-two-shoes? Well, THINK AGAIN! Watch hot, sexy MILFs run around like wild whores, fucking like wild animals and cheating on their loser husbands. Enjoy! 5 1 2009-07-16 Mature Adult Nosexyfuckingwildwhoreshusbandmilfmilfsshoes http://www.iphods.com/movie/579/wow-thats-what-i-call-sex-4/ http://www.iphods.com/videos/ff46f5bebc09c4f21c015d33d7ea5d73.m4v http://www.iphods.com/clips/thumbs/ff46f5bebc09c4f21c015d33d7ea5d73.jpg Wow! That's What I Call Sex #4 How about Pussy Pounding, Cock Sucking, Ass Fucking, Wet Pussies, Tight Asses and tons of group sex! Doesn't that sound like the best sex film ever! Well ladies and gentlemen that's what we have for you. Every and anything you could ever imagine is all listed in this featured film. You want see dildo's, threesomes, pussy eating, double penetration in the ass we have it and more. You've thought you've seen it but you haven't seen a thing until you rent this video... Make sure you get this one for you your viewing pleasure.... Enjoy cock-sucking, cum-swallowing whores in XXX hardcore action! 4 1 2009-07-16 Mature Adult Nococktightladiessuckingpleasurefilmdoublevideosuckhardcorepussiesanythingthreepoundinggroupdildowhoresassesfeaturedtight assfeatureviewpenetration http://www.iphods.com/movie/582/machine-sex-15/ http://www.iphods.com/videos/c75dd82a3178f4807b7ec53ddec658d4.m4v http://www.iphods.com/clips/thumbs/c75dd82a3178f4807b7ec53ddec658d4.jpg Machine Sex 15 This brand new series by Inflagranti is an absolute novelty on the European market, and the embodiment of cybernetic fetish fantasies. Its photography and original soundtrack are as unique and extraordinary as the fuck machine itself, which is constructed as the perfect sexual tool: unrelenting, inexhaustible and merciless. Watch luscious girls dressed up and strapped on the machine, slowing losing control of their bodies to the overpowering mechanics of this futuristic artifice. It's the most intimate sexual union between woman and machine, unheard of and never seen before this way. 3.5 1 2009-07-16 Mature Adult Nosexualwomanfetishintimateextrafantasiesoriginalpower http://www.iphods.com/movie/582/machine-sex-15/ http://www.iphods.com/videos/1b4add0116db2019c7ca4162b1bfe461.m4v http://www.iphods.com/clips/thumbs/1b4add0116db2019c7ca4162b1bfe461.jpg Machine Sex 15 This brand new series by Inflagranti is an absolute novelty on the European market, and the embodiment of cybernetic fetish fantasies. Its photography and original soundtrack are as unique and extraordinary as the fuck machine itself, which is constructed as the perfect sexual tool: unrelenting, inexhaustible and merciless. Watch luscious girls dressed up and strapped on the machine, slowing losing control of their bodies to the overpowering mechanics of this futuristic artifice. It's the most intimate sexual union between woman and machine, unheard of and never seen before this way. 4 1 2009-07-16 Mature Adult Nosexualwomanfetishintimateextrafantasiesoriginalpower http://www.iphods.com/movie/584/taboo-charming-mother-vol-5-slutty-stepmom/ http://www.iphods.com/videos/2b8f7964ddf55e007909e50a9a5e5e94.m4v http://www.iphods.com/clips/thumbs/2b8f7964ddf55e007909e50a9a5e5e94.jpg Taboo Charming Mother Vol. 5 - Slutty Stepmom Misako was in shock when she saw Kazuhiko engaging in a sexual act with Emiko. Having been surprised by this incident, Misako found herself feeling jealous and began to devise a plan to win Kazuhiko back. What obstacles will Misako overcome to get the lust she desires? This is the 5th installment of Tsuzuru Miyabi's infamous Taboo Charming Mother Series! Come on, you promised a show for them!!!This movie is featured in the original Japanese with English subtitles. 2 1 2009-07-15 Mature Adult Nosexualsurprisejapanesefeaturedoriginal http://www.iphods.com/movie/584/taboo-charming-mother-vol-5-slutty-stepmom/ http://www.iphods.com/videos/f314e499ac4848a2e71d428cc7c26b11.m4v http://www.iphods.com/clips/thumbs/f314e499ac4848a2e71d428cc7c26b11.jpg Taboo Charming Mother Vol. 5 - Slutty Stepmom Misako was in shock when she saw Kazuhiko engaging in a sexual act with Emiko. Having been surprised by this incident, Misako found herself feeling jealous and began to devise a plan to win Kazuhiko back. What obstacles will Misako overcome to get the lust she desires? This is the 5th installment of Tsuzuru Miyabi's infamous Taboo Charming Mother Series! Come on, you promised a show for them!!!This movie is featured in the original Japanese with English subtitles. 4 1 2009-07-15 Mature Adult Nosexualsurprisejapanesefeaturedoriginal http://www.iphods.com/movie/584/taboo-charming-mother-vol-5-slutty-stepmom/ http://www.iphods.com/videos/e7feceea6e17baa2c9f83f86acd7132f.m4v http://www.iphods.com/clips/thumbs/e7feceea6e17baa2c9f83f86acd7132f.jpg Taboo Charming Mother Vol. 5 - Slutty Stepmom Misako was in shock when she saw Kazuhiko engaging in a sexual act with Emiko. Having been surprised by this incident, Misako found herself feeling jealous and began to devise a plan to win Kazuhiko back. What obstacles will Misako overcome to get the lust she desires? This is the 5th installment of Tsuzuru Miyabi's infamous Taboo Charming Mother Series! Come on, you promised a show for them!!!This movie is featured in the original Japanese with English subtitles. 2.5 1 2009-07-15 Mature Adult Nosexualsurprisejapanesefeaturedoriginal http://www.iphods.com/movie/585/whorelore-3/ http://www.iphods.com/videos/432c4a7e6f1e24c8e64c5b38172eb9a3.m4v http://www.iphods.com/clips/thumbs/432c4a7e6f1e24c8e64c5b38172eb9a3.jpg Whorelore 3 The adventure continues with the elven priest Tiana and her half sister, Remus. Remus is sent on a quest to awaken a demon of the night. She must gather a set of articles in order to complete the ritual. However, all is not simple as Remus enlists the help of Tiana to obtain a special item. The Succubus is summoned for the ultimate seduction. 2.5 1 2009-07-11 Mature Adult Nonightcontinuesultimatecomplete http://www.iphods.com/movie/585/whorelore-3/ http://www.iphods.com/videos/273597994b1f2f2dd4d25ae7ff9454dd.m4v http://www.iphods.com/clips/thumbs/273597994b1f2f2dd4d25ae7ff9454dd.jpg Whorelore 3 The adventure continues with the elven priest Tiana and her half sister, Remus. Remus is sent on a quest to awaken a demon of the night. She must gather a set of articles in order to complete the ritual. However, all is not simple as Remus enlists the help of Tiana to obtain a special item. The Succubus is summoned for the ultimate seduction. 3 1 2009-07-11 Mature Adult Nonightcontinuesultimatecomplete http://www.iphods.com/movie/586/squirt-gangbang/ http://www.iphods.com/videos/88f668a7bc69247039acc8a8cf60abe4.m4v http://www.iphods.com/clips/thumbs/88f668a7bc69247039acc8a8cf60abe4.jpg Squirt Gangbang 2008 AVN Award Nominee for Best Squirting Release. Elegant Angel proudly presents the eagerly anticipated SQUIRT GANGBANG, starring Sasha Grey and Chelsie Rae. This movie is a torrential downpour of epic proportions. Imagine all of your favorite squirting vixens together in one room, directing all of their focus on drenching one very lucky (and very wet) porn princess. If you think you've seen squirting before in Squirtwoman, Swallow My Squirt, and Squirt In My Gape, then think again. SQUIRT GANGBANG is arguably greatest squirt series of them all and a non ride of orgasmic eruptions. DO NOT MISS! 4.5 1 2009-07-11 Mature Adult Nowomanorgasmpornridenomineeangeleagerfavoritesquirtingreleaseavn awardsquirtaward nomineeelegant angelbanglucky http://www.iphods.com/movie/587/squirt-facials/ http://www.iphods.com/videos/fa2f2bf3b84f30fb2711986079638830.m4v http://www.iphods.com/clips/thumbs/fa2f2bf3b84f30fb2711986079638830.jpg Squirt Facials Elegant Angel proudly brings you Squirt Facials, a compendium of the greatest squirt facials ever, from Elegant Angel's illustrious catalogue. Watch Cytherea douse Jenna Presley with her orgasm juices in brand new exclusive footage. Watch Angela Stone's volcanic eruption of squirt all over former Elegant Angel contract girl, Tiana Lynn. Featuring over 200 squirt facials and an all star cast including Jada Fire, Flower Tucci, Tiana Lynn, Cytherea, Jenna Presley, Sierra Sinn, Ariana Jollee, and many more squirting superstars. Bonus Footage Included 3 1 2009-07-10 Mature Adult Noorgasmfootfootageangelsquirtingsquirtelegant angellynnbonusflowersuperstar http://www.iphods.com/movie/587/squirt-facials/ http://www.iphods.com/videos/2f9ba40e7910447e7ba65260ecff8750.m4v http://www.iphods.com/clips/thumbs/2f9ba40e7910447e7ba65260ecff8750.jpg Squirt Facials Elegant Angel proudly brings you Squirt Facials, a compendium of the greatest squirt facials ever, from Elegant Angel's illustrious catalogue. Watch Cytherea douse Jenna Presley with her orgasm juices in brand new exclusive footage. Watch Angela Stone's volcanic eruption of squirt all over former Elegant Angel contract girl, Tiana Lynn. Featuring over 200 squirt facials and an all star cast including Jada Fire, Flower Tucci, Tiana Lynn, Cytherea, Jenna Presley, Sierra Sinn, Ariana Jollee, and many more squirting superstars. Bonus Footage Included 3 1 2009-07-10 Mature Adult Noorgasmfootfootageangelsquirtingsquirtelegant angellynnbonusflowersuperstar http://www.iphods.com/movie/587/squirt-facials/ http://www.iphods.com/videos/5752a27e9045a56234165d37c439fbbe.m4v http://www.iphods.com/clips/thumbs/5752a27e9045a56234165d37c439fbbe.jpg Squirt Facials Elegant Angel proudly brings you Squirt Facials, a compendium of the greatest squirt facials ever, from Elegant Angel's illustrious catalogue. Watch Cytherea douse Jenna Presley with her orgasm juices in brand new exclusive footage. Watch Angela Stone's volcanic eruption of squirt all over former Elegant Angel contract girl, Tiana Lynn. Featuring over 200 squirt facials and an all star cast including Jada Fire, Flower Tucci, Tiana Lynn, Cytherea, Jenna Presley, Sierra Sinn, Ariana Jollee, and many more squirting superstars. Bonus Footage Included 3.5 1 2009-07-10 Mature Adult Noorgasmfootfootageangelsquirtingsquirtelegant angellynnbonusflowersuperstar http://www.iphods.com/movie/591/naughty-little-asians-13/ http://www.iphods.com/videos/32465e0ec10e183f16bb5dd2a4e305a9.m4v http://www.iphods.com/clips/thumbs/32465e0ec10e183f16bb5dd2a4e305a9.jpg Naughty Little Asians 13 They are naughty, they are little, and they are Asian. So if you like it like that then your going to love it like this. These girls take it all in stride as they fuck and suck their way into your heart. Or should we say that you can fuck your way into theirs. Either way it is very hot. 2 1 2009-07-10 Mature Adult Noveryridenaughtyasian http://www.iphods.com/movie/591/naughty-little-asians-13/ http://www.iphods.com/videos/e2822d96cd3ff58f89d0cb3e3fa9838e.m4v http://www.iphods.com/clips/thumbs/e2822d96cd3ff58f89d0cb3e3fa9838e.jpg Naughty Little Asians 13 They are naughty, they are little, and they are Asian. So if you like it like that then your going to love it like this. These girls take it all in stride as they fuck and suck their way into your heart. Or should we say that you can fuck your way into theirs. Either way it is very hot. 2 1 2009-07-10 Mature Adult Noveryridenaughtyasian http://www.iphods.com/movie/592/amateur-wonders-2/ http://www.iphods.com/videos/c56da9f77be87555ffb02ff6ee307069.m4v http://www.iphods.com/clips/thumbs/c56da9f77be87555ffb02ff6ee307069.jpg Amateur Wonders 2 2008 AVN Award Nominee for Best MILF Release. Nina gets DP Action and Squirts! Hot MILF starlet of the year Kristal Summers takes deep dick! More DP action with Ultra Sultry Kylie! Revenge Psychology - he fucks her then she fucks him! It's hot pegging and strap-on action! Lola's comeback to porn doing guys, she's missed that dick! Bonus Footage Included 3 1 2009-07-10 Mature Adult Nodickdeepguysevenpornfootnomineefucksawardfootagereleaseavn awardsquirtaward nomineemilfbonuskrisninarevenge http://www.iphods.com/movie/592/amateur-wonders-2/ http://www.iphods.com/videos/f81a5d3f41a4b6081237f06baf622bc4.m4v http://www.iphods.com/clips/thumbs/f81a5d3f41a4b6081237f06baf622bc4.jpg Amateur Wonders 2 2008 AVN Award Nominee for Best MILF Release. Nina gets DP Action and Squirts! Hot MILF starlet of the year Kristal Summers takes deep dick! More DP action with Ultra Sultry Kylie! Revenge Psychology - he fucks her then she fucks him! It's hot pegging and strap-on action! Lola's comeback to porn doing guys, she's missed that dick! Bonus Footage Included 2.5 1 2009-07-10 Mature Adult Nodickdeepguysevenpornfootnomineefucksawardfootagereleaseavn awardsquirtaward nomineemilfbonuskrisninarevenge http://www.iphods.com/movie/594/top-notch-bitches-7/ http://www.iphods.com/videos/22beb3d4c0f5d8ca6036801ce7071f98.m4v http://www.iphods.com/clips/thumbs/22beb3d4c0f5d8ca6036801ce7071f98.jpg Top Notch Bitches 7 Gina Lynn takes on Lee Stone and devours his monster cock! Asa Akira does her first boy/girl on film! Mya McKay takes on Gina first and then the two cameramen! Rhylee Richards and Travis fuck each other silly! Tiffany Merlot is a first timer and she loves to get fucked! 3 1 2009-07-10 Mature Adult Nocockfilmdoescameralovesfirst timelynnrichardmonster http://www.iphods.com/movie/595/bi-bareback-orgy/ http://www.iphods.com/videos/8f26d7eda9d7cb91cdc65dabcba4000c.m4v http://www.iphods.com/clips/thumbs/8f26d7eda9d7cb91cdc65dabcba4000c.jpg Bi Bareback Orgy That slut Jessica Drew wants to spice things between her and boyfriend Farius Caine. She invites in young studs Rusty Stevenson, Kevin Rocha, Paul Black, and Johnny Walker. The pussy eating, cock sucking and raw cunt and ass fucking take over until everyone's desires are fulfilled. 3.5 1 2009-07-10 Mature Adult Nocockpussyyoungfuckingsuckingstudsveryblackslutboyfriendfilledcunt http://www.iphods.com/movie/597/the-greatest-squirts-ever-2/ http://www.iphods.com/videos/910d58e2156e3d42cab17056b8b7375c.m4v http://www.iphods.com/clips/thumbs/910d58e2156e3d42cab17056b8b7375c.jpg The Greatest Squirts Ever! 2 Ever since Cytherea's first orgasmic gushes of squirt on an Elegant Angel porn set the landscape of gonzo pornography was forever changed. While female orgasms have always been a pre-occupation of Elegant Angel owner, Patrick Collins, the awe struck delight he took in personally making Cytherea erupt girl goo all over his office furniture, the walls, the ceiling, and Elegant Angel videographer/director William H., redefined his entire company. What had previously been a remote niche' specialty was set for a contemporary overhaul as Patrick Collins infused the genre with the wonderment and marvel of a real porn fan that Cytherea's talents deserved. The result was "Cytherea Iz Squirtwoman," a rollercoaster, blockbuster success, and the beginnings of Elegant Angel's resurgence in the industry. Since the stratospheric success of the Squirtwoman series, Patrick Collins and William H. have thoroughly enjoyed themselves indulging in the squirting talents of a long list of gushing superstars: from "Squirtwoman," Cyth 4.5 1 2009-07-09 Mature Adult Nowomanvideoveryorgasmorgasmspornfemalealwaysangelusedofficesquirtingsquirtdirectorelegant angellynnfeaturedflowercollinsfeaturesuperstarmaletable http://www.iphods.com/movie/598/sindee-jones-is-supersquirt/ http://www.iphods.com/videos/85925c233f9a8ffeae08680dde85a7ed.m4v http://www.iphods.com/clips/thumbs/85925c233f9a8ffeae08680dde85a7ed.jpg Sindee Jones is Supersquirt 2009 AVN Award Nominee for Best Squirting ReleaseGet your slickers ready! Elegant Angel's hit series, Supersquirt, returns starring the insatiable Sindee Jennings, the newly crowned princess of orgasmic squirt eruptions.William H. has directed five scenes of face splashing, tit drenching, ass dousing, soaking wet debauchery. The torrential downpour of orgasmic fluids also stars Jenna Presley, Annie Cruz, Britney Stevenes, Chelsie Rae, and Flower Tucci. 2.5 1 2009-07-08 Mature Adult Nonomineeawardangelsquirtinginsatiablesquirtaward nomineeelegant angelflower http://www.iphods.com/movie/600/barely-legal-4/ http://www.iphods.com/videos/5396dc2c1cbab7480bb6bd6bd68cf090.m4v http://www.iphods.com/clips/thumbs/5396dc2c1cbab7480bb6bd6bd68cf090.jpg Barely Legal 4 Feeling patriotic? Barely Legal 4 celebrates our nation's sexual diversity serving up five slices of juicy, 18-year-old American pie. Savor more than a dozen beautiful girls from the shores of the Big Island to the gritty streets of New York City. In "Hawaiian Rose", an exotic innocent bids aloha to her virginity and lures two surfers to her secret wet spot. Sleazy sisters live the American dream and become erotic entrepreneurs in "Cheap at Any Price". Barely Legal 4's tender XXX collection also includes three more lurid peeks into the sizzling secret lives of the country's filthiest legal teens. Barely Legal 4 will make any red-blooded citizen swell with pride. 5 1 2009-07-03 Mature Adult Nobeautifulthreeridesecretbareincludesjuicycollectionsistersinnocent http://www.iphods.com/movie/600/barely-legal-4/ http://www.iphods.com/videos/4c75089c9e61827189fbd24ef8be56f0.m4v http://www.iphods.com/clips/thumbs/4c75089c9e61827189fbd24ef8be56f0.jpg Barely Legal 4 Feeling patriotic? Barely Legal 4 celebrates our nation's sexual diversity serving up five slices of juicy, 18-year-old American pie. Savor more than a dozen beautiful girls from the shores of the Big Island to the gritty streets of New York City. In "Hawaiian Rose", an exotic innocent bids aloha to her virginity and lures two surfers to her secret wet spot. Sleazy sisters live the American dream and become erotic entrepreneurs in "Cheap at Any Price". Barely Legal 4's tender XXX collection also includes three more lurid peeks into the sizzling secret lives of the country's filthiest legal teens. Barely Legal 4 will make any red-blooded citizen swell with pride. 3.5 1 2009-07-03 Mature Adult Nobeautifulthreeridesecretbareincludesjuicycollectionsistersinnocent http://www.iphods.com/movie/600/barely-legal-4/ http://www.iphods.com/videos/d4155f1dbc15d9f89f608444cc212bd7.m4v http://www.iphods.com/clips/thumbs/d4155f1dbc15d9f89f608444cc212bd7.jpg Barely Legal 4 Feeling patriotic? Barely Legal 4 celebrates our nation's sexual diversity serving up five slices of juicy, 18-year-old American pie. Savor more than a dozen beautiful girls from the shores of the Big Island to the gritty streets of New York City. In "Hawaiian Rose", an exotic innocent bids aloha to her virginity and lures two surfers to her secret wet spot. Sleazy sisters live the American dream and become erotic entrepreneurs in "Cheap at Any Price". Barely Legal 4's tender XXX collection also includes three more lurid peeks into the sizzling secret lives of the country's filthiest legal teens. Barely Legal 4 will make any red-blooded citizen swell with pride. 3.5 1 2009-07-03 Mature Adult Nobeautifulthreeridesecretbareincludesjuicycollectionsistersinnocent http://www.iphods.com/movie/601/ticklish-surprise/ http://www.iphods.com/videos/f98aab8d83680532e0f853c72606aabc.m4v http://www.iphods.com/clips/thumbs/f98aab8d83680532e0f853c72606aabc.jpg Ticklish Surprise 5 VERY ticklish girls....see it all in this video! Barefeet, nylons, stocks, arm cuffs, restrained on the sofa, hogtied, gagged, a foot massage that turns into wild tickling AND the Tickle Master at his best!!! You will see tickle torture of all kinds ~ foot tickling, armpits, knees, even a feather in the face and on the neck!! And we are so proud to introduce Avery. You won't want to miss her response and her incredible laughter!! 3.5 1 2009-07-03 Mature Adult Notiedmasterwildveryevenfeetfoottorturegaggedticklebarekneesticklishnylonincredibletickling http://www.iphods.com/movie/601/ticklish-surprise/ http://www.iphods.com/videos/14a4091b00111783f5d42795f04bceae.m4v http://www.iphods.com/clips/thumbs/14a4091b00111783f5d42795f04bceae.jpg Ticklish Surprise 5 VERY ticklish girls....see it all in this video! Barefeet, nylons, stocks, arm cuffs, restrained on the sofa, hogtied, gagged, a foot massage that turns into wild tickling AND the Tickle Master at his best!!! You will see tickle torture of all kinds ~ foot tickling, armpits, knees, even a feather in the face and on the neck!! And we are so proud to introduce Avery. You won't want to miss her response and her incredible laughter!! 4 1 2009-07-03 Mature Adult Notiedmasterwildveryevenfeetfoottorturegaggedticklebarekneesticklishnylonincredibletickling http://www.iphods.com/movie/602/facesitting-pantyhose/ http://www.iphods.com/videos/e2e14251b8e5ec258130d98c4f1a33b8.m4v http://www.iphods.com/clips/thumbs/e2e14251b8e5ec258130d98c4f1a33b8.jpg Facesitting Pantyhose Melissa is wearing the same clothes that Cris has on. She doesn't like that and asks Melissa to changes clothes, but Melissa doesn't want to. Cris being the cruel Mistress that she is decides to teach good manners to her friend. She sits down on Melissa's face with her black panties on, until her humiliated friend gets a good smell of her pussy. Then giving Melissa a chance to breath, Cris gets up and takes off her panties...but then sits right back down on her friend's face, making her smell and lick her ass and pussy until she arrives at orgasm. Although, humiliated, Cris really liked doing this film, as you will see by evidence of her soaking wet pussy! 2 1 2009-07-03 Mature Adult Nopussymistressfilmorgasmpantiesclothesdecide http://www.iphods.com/movie/602/facesitting-pantyhose/ http://www.iphods.com/videos/2dc88f761012055aa0779d082ef32ba6.m4v http://www.iphods.com/clips/thumbs/2dc88f761012055aa0779d082ef32ba6.jpg Facesitting Pantyhose Melissa is wearing the same clothes that Cris has on. She doesn't like that and asks Melissa to changes clothes, but Melissa doesn't want to. Cris being the cruel Mistress that she is decides to teach good manners to her friend. She sits down on Melissa's face with her black panties on, until her humiliated friend gets a good smell of her pussy. Then giving Melissa a chance to breath, Cris gets up and takes off her panties...but then sits right back down on her friend's face, making her smell and lick her ass and pussy until she arrives at orgasm. Although, humiliated, Cris really liked doing this film, as you will see by evidence of her soaking wet pussy! 5 1 2009-07-03 Mature Adult Nopussymistressfilmorgasmpantiesclothesdecide http://www.iphods.com/movie/602/facesitting-pantyhose/ http://www.iphods.com/videos/8a0f39a64170e3ada4f43a211df75e63.m4v http://www.iphods.com/clips/thumbs/8a0f39a64170e3ada4f43a211df75e63.jpg Facesitting Pantyhose Melissa is wearing the same clothes that Cris has on. She doesn't like that and asks Melissa to changes clothes, but Melissa doesn't want to. Cris being the cruel Mistress that she is decides to teach good manners to her friend. She sits down on Melissa's face with her black panties on, until her humiliated friend gets a good smell of her pussy. Then giving Melissa a chance to breath, Cris gets up and takes off her panties...but then sits right back down on her friend's face, making her smell and lick her ass and pussy until she arrives at orgasm. Although, humiliated, Cris really liked doing this film, as you will see by evidence of her soaking wet pussy! 3 1 2009-07-03 Mature Adult Nopussymistressfilmorgasmpantiesclothesdecide http://www.iphods.com/movie/602/facesitting-pantyhose/ http://www.iphods.com/videos/b610b2daa00c01cc9060fb9fd7701d30.m4v http://www.iphods.com/clips/thumbs/b610b2daa00c01cc9060fb9fd7701d30.jpg Facesitting Pantyhose Melissa is wearing the same clothes that Cris has on. She doesn't like that and asks Melissa to changes clothes, but Melissa doesn't want to. Cris being the cruel Mistress that she is decides to teach good manners to her friend. She sits down on Melissa's face with her black panties on, until her humiliated friend gets a good smell of her pussy. Then giving Melissa a chance to breath, Cris gets up and takes off her panties...but then sits right back down on her friend's face, making her smell and lick her ass and pussy until she arrives at orgasm. Although, humiliated, Cris really liked doing this film, as you will see by evidence of her soaking wet pussy! 3 1 2009-07-03 Mature Adult Nopussymistressfilmorgasmpantiesclothesdecide http://www.iphods.com/movie/604/sexercise/ http://www.iphods.com/videos/fabf30ff973f1d413b3142252c089560.m4v http://www.iphods.com/clips/thumbs/fabf30ff973f1d413b3142252c089560.jpg Sexercise Anal gymnastics are the lesson for today! But first you must warm up by doing a lot of sucking and stretching (and I don't mean your legs or arms). These hotties find any object they can use and stick right in their tight pussies! So what are you waiting for, sign up for a membership, now! 2 1 2009-07-03 Mature Adult Notightsuckingsuckanalpussieslegshottieslesson http://www.iphods.com/movie/606/transexual-prostitutes-54/ http://www.iphods.com/videos/3c43ccef25082bc18893a292595f60ad.m4v http://www.iphods.com/clips/thumbs/3c43ccef25082bc18893a292595f60ad.jpg Transexual Prostitutes 54 Do you LOVE your Trannys so much that you can taste it? Well then, this Special Ass Eating Edition is just for you! Every one of these luscious Trannys gets their turd-clipper munched, probed and licked clean by horny, lust crazed ass-raptors. What could be nastier than slipping your tongue deep inside some warm, stinking Tranny anus? NOTHING!! 3 1 2009-07-02 Mature Adult Nohornytonguecleantrannydeep inside http://www.iphods.com/movie/609/bi-bi-love-2/ http://www.iphods.com/videos/074237464f6aa6ddddf843727ae2f1a9.m4v http://www.iphods.com/clips/thumbs/074237464f6aa6ddddf843727ae2f1a9.jpg Bi-Bi Love #2 Any port in a storm...any hole will do. Doesn't matter whether the hot mouth belongs to a girl or a guy...or the hot ass either. If you want pussy...you got it...if you want dick...it's there too! The best of both...pick and choose your pleasure, and then take it for the ride of your life! 2 1 2009-07-02 Mature Adult Nopussydickpleasuredoesliferide http://www.iphods.com/movie/609/bi-bi-love-2/ http://www.iphods.com/videos/7e47e400d7cab5feda8730a1dac0bdd5.m4v http://www.iphods.com/clips/thumbs/7e47e400d7cab5feda8730a1dac0bdd5.jpg Bi-Bi Love #2 Any port in a storm...any hole will do. Doesn't matter whether the hot mouth belongs to a girl or a guy...or the hot ass either. If you want pussy...you got it...if you want dick...it's there too! The best of both...pick and choose your pleasure, and then take it for the ride of your life! 4 1 2009-07-02 Mature Adult Nopussydickpleasuredoesliferide http://www.iphods.com/movie/615/urban-perversions-viii/ http://www.iphods.com/videos/8d9607033af0851b3e9f3c902c81d92f.m4v http://www.iphods.com/clips/thumbs/8d9607033af0851b3e9f3c902c81d92f.jpg Urban Perversions VIII Wanna see weird sex, wanna enjoy the perversions of the European underground swinging scene? See weird masks, spanning, brutal face fucks, ball bitting, dildo sucking and nasty DP's. These sluts enjoy throat gagging, pussy licking and some hot 3 somes. All in a non-stop hardcore feature. 5 1 2009-06-26 Mature Adult Nopussynastysuckingsuckslutshardcoreslutdildolickingfucksropefeatureball http://www.iphods.com/movie/616/young-and-dumb-4/ http://www.iphods.com/videos/5920d7d053b2cf5e8a5e542f5e922043.m4v http://www.iphods.com/clips/thumbs/5920d7d053b2cf5e8a5e542f5e922043.jpg Young And Dumb 4 Jessica is no dummy. She just acts like it to get laid! Guys love stupid bimbos and these girls will be whatever you want them to be. Smack them up and tell them just how dumb they are... they won't care. They just want you're cum and to feel like the silly whores they are! 2 1 2009-06-26 Mature Adult Nogirlsgirlguyswhores http://www.iphods.com/movie/625/new-wave-hookers/ http://www.iphods.com/videos/a94557019768ba99fc44ad3e7dc84bfd.m4v http://www.iphods.com/clips/thumbs/a94557019768ba99fc44ad3e7dc84bfd.jpg New Wave Hookers XRCO Hall of Fame Movie! 1985 XRCO Award Winner for Best Group Scene. Critics agree that this is the best adult movie of 1985. That's what they said when this red-hot flick came out and it holds true today! As far as 'classic' flicks are concerned, this one is top notch! With all the cock sucking, pussy licking, anal stretching action you're looking for... it's sure to please! 3 1 2009-06-23 Mature Adult Nosuckinganalgrouplickingwinnerclassicadultaward winner http://www.iphods.com/movie/633/sinema/ http://www.iphods.com/videos/dff913d685f257b7c848c364537efa2f.m4v http://www.iphods.com/clips/thumbs/dff913d685f257b7c848c364537efa2f.jpg Sinema A world famous photographer creates images on the computer for her upcoming project. Her creative mind lets her dream away into her most erotic fantasies, creating intense erotic and sexual experiences that her mind desires. Not only does she create these intense images, but she also comes alive in these extreme fantasies. 2.5 1 2009-06-19 Mature Adult Noexperiencesexualdoesintenseeroticfantasiesmindextreme http://www.iphods.com/movie/635/the-orifice/ http://www.iphods.com/videos/a37b74152c7b0b112a46e9237dc3e272.m4v http://www.iphods.com/clips/thumbs/a37b74152c7b0b112a46e9237dc3e272.jpg The Orifice Regional manager Steve thinks he's the coolest, sexiest boss ever. His co-worker Tim lusts after hot receptionist Patti when he's not sabotaging his cube-mate, the know-it-all ice queen Darla. The office is shaken up when Steve decides to hire a gorgeous new secretary, played by Tera Wray, and as the interviews begin, office politics turns to sexual politics. 2.5 1 2009-06-16 Mature Adult Noplaysecretofficesexiestbossplayedviewdecidequeenwhen he http://www.iphods.com/movie/635/the-orifice/ http://www.iphods.com/videos/b7a746b36cdc8921f3c052498f17632a.m4v http://www.iphods.com/clips/thumbs/b7a746b36cdc8921f3c052498f17632a.jpg The Orifice Regional manager Steve thinks he's the coolest, sexiest boss ever. His co-worker Tim lusts after hot receptionist Patti when he's not sabotaging his cube-mate, the know-it-all ice queen Darla. The office is shaken up when Steve decides to hire a gorgeous new secretary, played by Tera Wray, and as the interviews begin, office politics turns to sexual politics. 4 1 2009-06-16 Mature Adult Noplaysecretofficesexiestbossplayedviewdecidequeenwhen he http://www.iphods.com/movie/1408/briana-banks-more-lesbian-action/ http://www.iphods.com/videos/f586aea6238f0a6eb32f3b3277264b36.m4v http://www.iphods.com/clips/thumbs/f586aea6238f0a6eb32f3b3277264b36.jpg Briana Banks: More Lesbian Action Briana has a body anyone would die for...long, luscious legs, full round tits, and a tiny, tight ass that just begs for a reaming. Now you can see her beautiful body twist and bend in every position imaginable, in this collection of her award-winning sex scenes! Girl-on-girl, guy-on-girl, or just girl-on-herself, don't miss this breathtaking collection of the best scenes adult entertainment has to offer - especially with Briana Banks! 2 1 2005-04-22 Mature Adult Nogirltitsbeautifultightbodyverylegsawardespeciallyadultcollectiontight asssex sceneposition http://www.iphods.com/movie/639/doctor-deangelo/ http://www.iphods.com/videos/060764feab0744980240cb29c2e987d8.m4v http://www.iphods.com/clips/thumbs/060764feab0744980240cb29c2e987d8.jpg Doctor DeAngelo At last a treatment has been found for those who suffer from the rare psychosis Bondage Fantasy Syndrome (BFS). Dr. DeAngelo has developed a therapy involving the re-enactment of bondage fantasies. Her newest subjects, the voluptuous blonde Tawny and curvaceous red head Miss Snow will actually experience tight bondage in many varied positions. In their futile struggles for freedom they will encounter their true inner selves. Of course, were not entirely surprised to learn that Dr. DeAngelo has a few bondage fantasies of her own! 4 1 2009-06-13 Mature Adult Nobondageexperienceblondesurpriseangellearnpositionsfantasiesfantasypositionvoluptuousfree http://www.iphods.com/movie/639/doctor-deangelo/ http://www.iphods.com/videos/0ac435a5446b1fcf46a67e75a0dc75fd.m4v http://www.iphods.com/clips/thumbs/0ac435a5446b1fcf46a67e75a0dc75fd.jpg Doctor DeAngelo At last a treatment has been found for those who suffer from the rare psychosis Bondage Fantasy Syndrome (BFS). Dr. DeAngelo has developed a therapy involving the re-enactment of bondage fantasies. Her newest subjects, the voluptuous blonde Tawny and curvaceous red head Miss Snow will actually experience tight bondage in many varied positions. In their futile struggles for freedom they will encounter their true inner selves. Of course, were not entirely surprised to learn that Dr. DeAngelo has a few bondage fantasies of her own! 2 1 2009-06-13 Mature Adult Nobondageexperienceblondesurpriseangellearnpositionsfantasiesfantasypositionvoluptuousfree http://www.iphods.com/movie/639/doctor-deangelo/ http://www.iphods.com/videos/68fad7846e400ba4ad47340db9fc73a9.m4v http://www.iphods.com/clips/thumbs/68fad7846e400ba4ad47340db9fc73a9.jpg Doctor DeAngelo At last a treatment has been found for those who suffer from the rare psychosis Bondage Fantasy Syndrome (BFS). Dr. DeAngelo has developed a therapy involving the re-enactment of bondage fantasies. Her newest subjects, the voluptuous blonde Tawny and curvaceous red head Miss Snow will actually experience tight bondage in many varied positions. In their futile struggles for freedom they will encounter their true inner selves. Of course, were not entirely surprised to learn that Dr. DeAngelo has a few bondage fantasies of her own! 3.5 1 2009-06-13 Mature Adult Nobondageexperienceblondesurpriseangellearnpositionsfantasiesfantasypositionvoluptuousfree http://www.iphods.com/movie/640/the-process-/ http://www.iphods.com/videos/ac21538958ea2ad4d91eb94c4058749a.m4v http://www.iphods.com/clips/thumbs/ac21538958ea2ad4d91eb94c4058749a.jpg The Process Ivy doesn't know what's been hidden in her house. She's completely confused when Orchid hogties her on the bed and rifles through her belongings. Orchid finds herself bound next to Ivy on the bed when a WASP enters the scene and makes off with The Process. Now secreted in unsuspecting August's apartment, she is set upon by April. No time for gloating, because Summer makes them a twosome in rope. Blue, an ally of April, rushes in to assist, handcuffing Summer and August to the radiator. But things go bad for April when Blue takes advantage of claiming The Process and leaving all three women bound in the bedroom wearing nothing but their pantyhose. And now April must face the interrogation of The Counsel for her failure to bring home The Process. 4.5 1 2009-06-13 Mature Adult Noboundwomendoesthreeropesecretusedbedroomcompletelypantyhosecompleteunsuspectingapartmentblue http://www.iphods.com/movie/644/bimbo-club-big-boobs/ http://www.iphods.com/videos/92ae43f4d1b55b48fdb6355231efcdaf.m4v http://www.iphods.com/clips/thumbs/92ae43f4d1b55b48fdb6355231efcdaf.jpg Bimbo Club Big Boobs Work hard, enjoy sex . . . What to do when a worker is exhausted and furious? Please call the secretary and ask for assistance . . . Press 1 for a blowjob . . . Coaching: The coach is finishing the practice with beautiful young girls eager to discover sexual pleasures. A good secretary . . . The formula for a good secretary? Good in spelling, being an expert on blowjobs and "opened" on both sides to all of her boss's ideas!!! Water pink ballet: Two young hunks and one gorgeous girl with big breasts are presenting their new choreography: deep penetrations, pussy eating and even double penetrations . . . the final artistic mark? 10/10! Sapphic fantasies: Imagine what is happening when two girls are playing with dildos . . . it is an explosion of pleasures. Angel for sex: With her friends, a beautiful blonde-haired girl is offering her holes to her partner and discovers the real sense of being in seventh heaven! Fixing a car, opening holes . . . Nothing is easier for a gorgeous young girl with b 2.5 1 2009-06-13 Mature Adult Nopussyyoungpleasuredeepsexualdoubleevenplayblondefriendsdildoholesblowjobssecretangelhaireagerfantasiesblowcallbreastsdildosboobsbossballtwo girlspartnerpenetration http://www.iphods.com/movie/644/bimbo-club-big-boobs/ http://www.iphods.com/videos/65dc760c6d65313417ec6704c0e88331.m4v http://www.iphods.com/clips/thumbs/65dc760c6d65313417ec6704c0e88331.jpg Bimbo Club Big Boobs Work hard, enjoy sex . . . What to do when a worker is exhausted and furious? Please call the secretary and ask for assistance . . . Press 1 for a blowjob . . . Coaching: The coach is finishing the practice with beautiful young girls eager to discover sexual pleasures. A good secretary . . . The formula for a good secretary? Good in spelling, being an expert on blowjobs and "opened" on both sides to all of her boss's ideas!!! Water pink ballet: Two young hunks and one gorgeous girl with big breasts are presenting their new choreography: deep penetrations, pussy eating and even double penetrations . . . the final artistic mark? 10/10! Sapphic fantasies: Imagine what is happening when two girls are playing with dildos . . . it is an explosion of pleasures. Angel for sex: With her friends, a beautiful blonde-haired girl is offering her holes to her partner and discovers the real sense of being in seventh heaven! Fixing a car, opening holes . . . Nothing is easier for a gorgeous young girl with b 4.5 1 2009-06-13 Mature Adult Nopussyyoungpleasuredeepsexualdoubleevenplayblondefriendsdildoholesblowjobssecretangelhaireagerfantasiesblowcallbreastsdildosboobsbossballtwo girlspartnerpenetration http://www.iphods.com/movie/647/nice-fucking-tits-memphis-monroe/ http://www.iphods.com/videos/36fc8812ea40a6fd5282eaa6c075bd0a.m4v http://www.iphods.com/clips/thumbs/36fc8812ea40a6fd5282eaa6c075bd0a.jpg Nice Fucking Tits - Memphis Monroe Elegant Angel presents Nice Fucking Tits, a breathtaking compendium of the industry's most well endowed superstars including Angel Dark, Tory Lane, Sammie Rhodes, and Pandora Dreams. Watch an onslaught of eight scenes and three hours featuring non-stop nipple sucking, cleavage bulging, chest groping, and tit fucking. This compilation is an unrelenting glorification of Nice Fucking Tits. Your ball sacks won't be the same after watching! Nice Fucking Tits, is an all star compendium from Elegant Angel, the company that porn fans can rely upon for a more creative and visceral brand of eroticism. 5 1 2009-06-12 Mature Adult Notitsfuckingsuckingnicepornthreeeroticangeldarkelegant angelsuperstarballnipplefans http://www.iphods.com/movie/650/rubber-training/ http://www.iphods.com/videos/bc4a1fdc5aee98e0bc122268293694f1.m4v http://www.iphods.com/clips/thumbs/bc4a1fdc5aee98e0bc122268293694f1.jpg Rubber Training Rubberella's routine training session goes awry when Jewell Marceau makes her last critical mistake when demonstrating what she has learned on the obedient, rubberized slave girl Darby. When Jewell is practicing her flogging skills on Darby's tight, round bottom and hits Rubberella instead, that is the last straw for Mistress Jean Bardot! Through rigorous punishment, torture, and latex in casement; Mistress Jean finally convinces Jewell that she is more suitable on her hands and knees worshipping her latex boots than trying her hand at the whip! 3.5 1 2009-06-09 Mature Adult Nopunishmenttightslavehandsmistressfinallytorturebottomtraininglearnwhipbootsrubberjewelllatexkneesmarceautablejewell marceau http://www.iphods.com/movie/743/project-nylon-1/ http://www.iphods.com/videos/1a11299dd5288fa5d7ff3afccda2e500.m4v http://www.iphods.com/clips/thumbs/1a11299dd5288fa5d7ff3afccda2e500.jpg Project Nylon 1 Are you looking for a little more than drab and regular sexual encounters? Do you need a little extra to get you fully aroused? Watch as these babes incorporate their nylons and stocking into some steamy and erotically lustful sex that is passionate and exotic!!! 2.5 1 2009-04-17 Mature Adult Nosexualeroticusedextrasteamycallpassionateregularnylon http://www.iphods.com/movie/667/big-black-butts-3/ http://www.iphods.com/videos/6452ffa1fa6afdde77406595b49c7957.m4v http://www.iphods.com/clips/thumbs/6452ffa1fa6afdde77406595b49c7957.jpg Big Black Butts 3 If you love to see big beautiful voluptuous women then you've come to the right place, this Busty Hot Mama can spread them wide for her man. Watch as she rides, slides and glides all over that dick. Feast your eyes on this fancy feast while she get tasted from front to back. 4.5 1 2009-05-29 Mature Adult Nobeautifuldickrideeyesbustyspreadvoluptuous http://www.iphods.com/movie/667/big-black-butts-3/ http://www.iphods.com/videos/3e72b546f5a4c0873c0f564c22f45886.m4v http://www.iphods.com/clips/thumbs/3e72b546f5a4c0873c0f564c22f45886.jpg Big Black Butts 3 If you love to see big beautiful voluptuous women then you've come to the right place, this Busty Hot Mama can spread them wide for her man. Watch as she rides, slides and glides all over that dick. Feast your eyes on this fancy feast while she get tasted from front to back. 4.5 1 2009-05-29 Mature Adult Nobeautifuldickrideeyesbustyspreadvoluptuous http://www.iphods.com/movie/667/big-black-butts-3/ http://www.iphods.com/videos/5e91c1f8fb07682d0356339620f3cf8e.m4v http://www.iphods.com/clips/thumbs/5e91c1f8fb07682d0356339620f3cf8e.jpg Big Black Butts 3 If you love to see big beautiful voluptuous women then you've come to the right place, this Busty Hot Mama can spread them wide for her man. Watch as she rides, slides and glides all over that dick. Feast your eyes on this fancy feast while she get tasted from front to back. 2.5 1 2009-05-29 Mature Adult Nobeautifuldickrideeyesbustyspreadvoluptuous http://www.iphods.com/movie/667/big-black-butts-3/ http://www.iphods.com/videos/1d0633ee7e39ceb7bc057c496d3a1e4f.m4v http://www.iphods.com/clips/thumbs/1d0633ee7e39ceb7bc057c496d3a1e4f.jpg Big Black Butts 3 If you love to see big beautiful voluptuous women then you've come to the right place, this Busty Hot Mama can spread them wide for her man. Watch as she rides, slides and glides all over that dick. Feast your eyes on this fancy feast while she get tasted from front to back. 2.5 1 2009-05-29 Mature Adult Nobeautifuldickrideeyesbustyspreadvoluptuous http://www.iphods.com/movie/759/secretarys-day-2/ http://www.iphods.com/videos/4ae7f9da25a4616e232e18c5b12a7611.m4v http://www.iphods.com/clips/thumbs/4ae7f9da25a4616e232e18c5b12a7611.jpg Secretary's Day 2 They say when the boss is away, the secretaries will play! See what Jenna Haze does for the boss when she's caught fucking on the job. Tori Black takes interracial dicktation to score a new gig. Jenny Hendrix and Rebecca Linares get into an office catfight and up sharing the bosses cock. Rachel Starr finds porn on the company computer and then gets fucked hard. Dakota Brooks will do whatever it takes to land the big account. 2.5 1 2009-04-03 Mature Adult Nofuckingdickplayblackporndoessecretofficecaughtbossinterracial http://www.iphods.com/movie/673/racial-violations-2/ http://www.iphods.com/videos/d0eb930325d22aa513f0a5e09021ea1b.m4v http://www.iphods.com/clips/thumbs/d0eb930325d22aa513f0a5e09021ea1b.jpg Racial Violations 2 Director L.T. returns with an interracial movie for Elegant Angel, RACIAL VIOLATIONS #2. Featuring an incredible all-star cast including Rebeca Linares, Luscious Lopez, Sophie Dee, Leah Jaye, Holly Wellin, Jazmine Leih, Leilani, and Dana DeArmond. The movie features five vignettes, and almost three hours of intense hardcore f*cking. L.T. is re-invigorating Elegant Angel's ethnic content with his brand of creative scene set-ups, and the hottest porn stars in the industry. Do not miss RACIAL VIOLATIONS #2. 4 1 2009-05-27 Mature Adult Nohottesthardcorethreeintenseangeldirectorelegant angelfeatureinterracialincredible http://www.iphods.com/movie/679/hit-me-with-your-black-cock/ http://www.iphods.com/videos/290aa5e6fa0314cdb3ec457a9ab86f12.m4v http://www.iphods.com/clips/thumbs/290aa5e6fa0314cdb3ec457a9ab86f12.jpg Hit Me With Your Black Cock Ava Rose and Bridgette Kerkova are but two of the superstar cuties who have a taste for the sweetest taboo...BIG BLACK COCK! They take the biggest darkest rods in everyhole...even absorbing some impossibly big shafts in some cute tight asses...only to then pull out and swallow that hot cum! From Ethnicity Films... the absolute best in Interracial Sex! 5 1 2009-05-23 Mature Adult Nococktightfilmevencutedarkassesbig blacktight assfilmsinterracialsuperstarbiggest http://www.iphods.com/movie/686/classic-striptease-glamour-films-16/ http://www.iphods.com/videos/0bb107ff0ed215a96e821e5e49d8ecd6.m4v http://www.iphods.com/clips/thumbs/0bb107ff0ed215a96e821e5e49d8ecd6.jpg Classic Striptease and Glamour Films 16 SWEATER GIRLS Plus 6 voluptuous TITBITS, with dazzling Busty Babes LAINE CARLIN onstage and in boudoir, MICHELLE ANGELO in her infamous black shell brassiere, LILLIAN PARKER really up close and personal, and LEE GERMAINE doing 10 different Tit Wiggles and Tit Jiggles, all from original camera masters. 3 1 2009-05-22 Mature Adult Nogirlmasterblackcamerahellangelmichellecarlibustyoriginalclosevoluptuous http://www.iphods.com/movie/687/masturbation-celebration/ http://www.iphods.com/videos/bfc2433425a9fba47feb6cb57d54e979.m4v http://www.iphods.com/clips/thumbs/bfc2433425a9fba47feb6cb57d54e979.jpg Masturbation Celebration Sweetmeats proudly presents, the all girl gathering where no one leaves until every pussy is soaking and satisfied!! More real orgasms and totally drenched pussies make Masturbation Celebration another one of our finest films. Be sure not to miss this, sex fiends! 4 1 2009-05-22 Mature Adult Nogirlorgasmorgasmspussiesmasturbationfilmsendsleaves http://www.iphods.com/movie/694/chunky-mature-women-12/ http://www.iphods.com/videos/59cdbf8f7d1bcd35052b044123ac5702.m4v http://www.iphods.com/clips/thumbs/59cdbf8f7d1bcd35052b044123ac5702.jpg Chunky Mature Women 12 Chunky, older women fuck better than your wife! They have the poundage and the experience to please you... but don't you dare tell the little woman! It is always better with a little cushion for the pushing, they have what it takes to rock your world, and sink you boat. 3 1 2009-05-21 Mature Adult Noexperiencewomenwomanalwayswifeolder http://www.iphods.com/movie/694/chunky-mature-women-12/ http://www.iphods.com/videos/52b299f1eeea17a53b98267e7e3a7282.m4v http://www.iphods.com/clips/thumbs/52b299f1eeea17a53b98267e7e3a7282.jpg Chunky Mature Women 12 Chunky, older women fuck better than your wife! They have the poundage and the experience to please you... but don't you dare tell the little woman! It is always better with a little cushion for the pushing, they have what it takes to rock your world, and sink you boat. 4 1 2009-05-21 Mature Adult Noexperiencewomenwomanalwayswifeolder http://www.iphods.com/movie/695/big-wet-asses-11/ http://www.iphods.com/videos/22c6d7e11897e067f97876538a4c12f1.m4v http://www.iphods.com/clips/thumbs/22c6d7e11897e067f97876538a4c12f1.jpg Big Wet Asses! 11 Big Wet Asses, the winner of AVN's coveted Best Anal Themed Series award for 2006 7 2007, is back! Volume 11 stars the bubble butted cutie pie, Julia Bond, performing in a much anticipated anal scene. Michael Stefano guides her tight ass-hole through 30 minutes of breath-taking ass veneration. Julia is joined in the cast by Brianna Love, Annette Schwarz, Maya Hills, Cody Lane, and Sativa Rose. Do not miss this voluptuous all star cast drenched in oil and ass fucked for your delectation. 4.5 1 2009-05-20 Mature Adult Nolovetightbuttawardjoinwinnerassestight assbriannabrianna lovevoluptuous http://www.iphods.com/movie/695/big-wet-asses-11/ http://www.iphods.com/videos/fa51662f6f7c16439f92d98100f28817.m4v http://www.iphods.com/clips/thumbs/fa51662f6f7c16439f92d98100f28817.jpg Big Wet Asses! 11 Big Wet Asses, the winner of AVN's coveted Best Anal Themed Series award for 2006 7 2007, is back! Volume 11 stars the bubble butted cutie pie, Julia Bond, performing in a much anticipated anal scene. Michael Stefano guides her tight ass-hole through 30 minutes of breath-taking ass veneration. Julia is joined in the cast by Brianna Love, Annette Schwarz, Maya Hills, Cody Lane, and Sativa Rose. Do not miss this voluptuous all star cast drenched in oil and ass fucked for your delectation. 4 1 2009-05-20 Mature Adult Nolovetightbuttawardjoinwinnerassestight assbriannabrianna lovevoluptuous http://www.iphods.com/movie/695/big-wet-asses-11/ http://www.iphods.com/videos/f5e30c48650f7a4aa269a531ce991a57.m4v http://www.iphods.com/clips/thumbs/f5e30c48650f7a4aa269a531ce991a57.jpg Big Wet Asses! 11 Big Wet Asses, the winner of AVN's coveted Best Anal Themed Series award for 2006 7 2007, is back! Volume 11 stars the bubble butted cutie pie, Julia Bond, performing in a much anticipated anal scene. Michael Stefano guides her tight ass-hole through 30 minutes of breath-taking ass veneration. Julia is joined in the cast by Brianna Love, Annette Schwarz, Maya Hills, Cody Lane, and Sativa Rose. Do not miss this voluptuous all star cast drenched in oil and ass fucked for your delectation. 4.5 1 2009-05-20 Mature Adult Nolovetightbuttawardjoinwinnerassestight assbriannabrianna lovevoluptuous http://www.iphods.com/movie/696/brianna-love-is-buttwoman/ http://www.iphods.com/videos/e68658386224a51b4c03a0a6906e96d5.m4v http://www.iphods.com/clips/thumbs/e68658386224a51b4c03a0a6906e96d5.jpg Brianna Love Is Buttwoman 2008 AVN Award Winner for Best Gonzo Release plus 2008 AVN Award Nominee for Best Oral Sex Sex Scene - Video, Nominee for Best Couples Sex Scene - Video and Nominee for Best Director - Non-Feature.From her beautiful face, and girly expressions, to her buxom curves and gigantic rear end, Brianna Love is a mesmerizing superstar. There have been few girls in pornography more visually spellbinding than the newly crowned Buttwoman. BRIANNA LOVE IS BUTTWOMAN features five scenes that collectively demonstrate the beauty of female curves. The movie is directed by AVN Award Winning, William H. and his partner in depravity Sam No. The visually stunning butt-themed debauchery also stars "Squirtwoman" Jada Fire, Carmella Bing, and the sublime superstar Sunny Lane. The latest installment of Buttwoman further stamps its mark on one of the all time classic Elegant Angel series and heralds Brianna Love is one of the sweetest, prettiest, and sexiest girls that you will find in pornography today. Enjoy! 3.5 1 2009-05-20 Mature Adult Nogirlslovegirlbeautifulwomanvideopornfemalebuttnomineeawardwinnerangeloralclassicsexiestcouplesreleaseavn awardsquirtaward nomineedirectorelegant angelsex scenecouplefeaturebriannasuperstarbrianna lovepartneraward winner,best director http://www.iphods.com/movie/697/brianna-love-her-fine-sexy-self/ http://www.iphods.com/videos/965b267a2a4ea16940ed4722b4b9e12b.m4v http://www.iphods.com/clips/thumbs/965b267a2a4ea16940ed4722b4b9e12b.jpg Brianna Love: Her Fine Sexy Self 2008 XRCO Award Nominee for Best Gonzo Release. 2008 AVN Award Nominee for Best Video Feature. 2008 AVN Award Winner for Best Tease Performance. 2008 AVN Award Nominee for Best Supporting Actor, Video - Derrick Pierce. 2008 AVN Award Nominee for Best Music. 2008 AVN Award Nominee for Best Editing - Film. 2008 AVN Award Nominee for Best Non-Sex Performance - John Leslie. 2008 AVN Award Nominee for Best Director - Video. 2008 AVN Award Nominee for Best Actress - Film. The legendary John Leslie triumphantly returns to feature filmmaking with this sexual drama, a star vehicle showcasing the skills of the delectable Brianna Love. Brianna plays a ballsy, fun-loving babe who frequents a busy neighborhood bar where Frankie Dap (Leslie), who's known her all her life, hangs out. A trusting sort, Brianna fucks various guys until she runs into an unexpected situation. When another bar girl (Christina Aguchi) nearly falls prey to the same danger, the scene is set for a thrilling climax, and a clash between bad a 3.5 1 2009-05-20 Mature Adult Nolovewomenguysballsvideoplaylifecameranomineefucksawardwinnerstoryclassicreleaseavn awardaward nomineedirectorbriannaballbrianna lovetablemusicaward winnerbest directorbest supporting http://www.iphods.com/movie/701/addicted-to-boobs-6/ http://www.iphods.com/videos/5b2eae0c3fbc30f23455724f02d680dc.m4v http://www.iphods.com/clips/thumbs/5b2eae0c3fbc30f23455724f02d680dc.jpg Addicted To Boobs 6 Since the beginning of time, man has been Addicted To Boobs. He loves to look at, squeeze, fondle and suck on, big natural boobs. If being addicted to big juicy boobies is a sickness, then call me a Dr. Here's our latest installment praising the mighty mammaries!! 4.5 1 2009-05-15 Mature Adult Nosucklovesnaturaljuicycallboobs http://www.iphods.com/movie/704/hitchhiker-girls-in-heat/ http://www.iphods.com/videos/785e4f68aff0cd45c8547a51cf568866.m4v http://www.iphods.com/clips/thumbs/785e4f68aff0cd45c8547a51cf568866.jpg Hitchhiker Girls In Heat Released as "Auto-Stoppeusses En Chaleur"What husband who sets off driving to meet up with his wife on vacation hasn't dreamed of having steamy encounters along the way? This is exactly what happened to Frank, who kicks off his journey by meeting two Danish hitchhikers in heat - and finishes it worn out by all the beautiful sluts that lined the road. Drop-dead beauties, bitches-to-go, abound in this film. The steamy climax of the journey is reached with the fascinating Brigitte Lahaie, expert in pleasures of all kinds. A huge hit from the golden age of France's "Cinema X" era, this film debuted in Paris on 6.27.1979 in ALPHA FRANCE theaters. Quel mari Partant replique en voiture sa femme en vacances n'at-il pas reve de faire sur son chemin des rencontres excitantes? C'est le cas de Francois qui periple fils commencer par la rencontre de 2 auto-stoppeuses Danoises en chaleur ... et le termine epuise par toutes les belles Salopes qui ont jalonne sa route. Des creatures affriolantes, Chiennes a souhait, abo 4.5 1 2009-05-15 Mature Adult Nobeautifulboundpleasurefilmsluthugewifesteamybitcheshusbandrelease http://www.iphods.com/movie/480/deep-inside-samantha-fox/ http://www.iphods.com/videos/397e5836e6c9f9f3f4a97271d7b6e588.m4v http://www.iphods.com/clips/thumbs/397e5836e6c9f9f3f4a97271d7b6e588.jpg Deep Inside Samantha Fox Samantha Fox was born in NYC in the 1950's. Throughout her younger years she became heavily involved in dance, eventually dancing as a professional. She is an intense and sizzling brunette, with a gorgeous body. Her first adult role was in the Video-X-Pix hit, Bad Penny (1978), directed by Chuck Vincent. After this, she began to take on lead roles as an adult starlet and shortly after entering the industry Samantha was already on her way to legendary status. She was indeed a true gem of the age. Her on screen chemistry and scenes with performer/husband, Bobby Astyr, were among the most entertaining of all time. This collection of Samantha Fox's most erotic scenes from the VXP vault is a must have for any serious collector of Golden Age Erotica. This is vintage porn at it's finest. 4.5 1 2009-08-27 Mature Adult Nobodyvideoevenpornintensebrunetteeroticshorthusbandadultcollectiondancingeventually http://www.iphods.com/movie/710/virgin-hostage/ http://www.iphods.com/videos/14da77b11e3e7f3605077bb5d351f5ae.m4v http://www.iphods.com/clips/thumbs/14da77b11e3e7f3605077bb5d351f5ae.jpg Virgin Hostage The present print of Virgin Hostage seems to be missing a bit of introductory material, but it starts off with a car racing away from what we soon discover was a band robbery. Swish pans, shaky hand-held camera work and a twangy, Merseybeat soundtrack underscore the excitement. Meanwhile, two hippy chicks in shorty sundresses are seen walking out of a building. The girls chitchat about the upcoming weekend and, flashing forward to their "apartment" - you know, the one that always looks like a hotel room - they call a few friends and ask them to drop by later with some takeout chicken. Outside the girls' building, the three bank robbers inspect the apparently inoperative engine of their getaway car. Toting a couple of guns and a paper sack full of money, they decide to hole up nearby. Cut to the interior of the girl's apartment; the gangsters rush in brandishing their rods. One of the chicks - a flabby, pasty-assed, bleached blonde - just happens to be (yuck!) nude at the moment; the other girl - a jappy look 2 1 2009-05-15 Mature Adult Nodicksuckingforcedsuckplayblondeporndoescamerachicksthreefriendsgaggedbrunettealwayswillingshorthairalonecallchickorgycoupleplayedgirlfrienddecidefloorpartnerapartmentdancingmusic http://www.iphods.com/movie/710/virgin-hostage/ http://www.iphods.com/videos/44d804fafd2925251c2c96d50bc9ce6e.m4v http://www.iphods.com/clips/thumbs/44d804fafd2925251c2c96d50bc9ce6e.jpg Virgin Hostage The present print of Virgin Hostage seems to be missing a bit of introductory material, but it starts off with a car racing away from what we soon discover was a band robbery. Swish pans, shaky hand-held camera work and a twangy, Merseybeat soundtrack underscore the excitement. Meanwhile, two hippy chicks in shorty sundresses are seen walking out of a building. The girls chitchat about the upcoming weekend and, flashing forward to their "apartment" - you know, the one that always looks like a hotel room - they call a few friends and ask them to drop by later with some takeout chicken. Outside the girls' building, the three bank robbers inspect the apparently inoperative engine of their getaway car. Toting a couple of guns and a paper sack full of money, they decide to hole up nearby. Cut to the interior of the girl's apartment; the gangsters rush in brandishing their rods. One of the chicks - a flabby, pasty-assed, bleached blonde - just happens to be (yuck!) nude at the moment; the other girl - a jappy look 3.5 1 2009-05-15 Mature Adult Nodicksuckingforcedsuckplayblondeporndoescamerachicksthreefriendsgaggedbrunettealwayswillingshorthairalonecallchickorgycoupleplayedgirlfrienddecidefloorpartnerapartmentdancingmusic http://www.iphods.com/movie/711/wayward-mistress-/ http://www.iphods.com/videos/e2639de89c66c5c519ee08b8997953d8.m4v http://www.iphods.com/clips/thumbs/e2639de89c66c5c519ee08b8997953d8.jpg Wayward Mistress Poor Cindy does not think her boyfriend Ric (played by West Coast porn workhorse, Ric Lutze) understands her. In spite of a great sex life - amply demonstrated on screen - she feels the need to get away and think through their relationship. What better place to do this than with a girlfriend who hooks for a living? At least if Cindy can't get her head together, she can give a little head. Watching from an adjoining room, Cindy observes her pal Barbara getting it on with a middle-aged hippy (who looks a bit like David Crosby) and gets a little hot between the thighs herself. After the trick leaves, the two girls swap fluids on the living room sofa until the next client appears, an amateur photographer. Barbara welcomes the shutterbug to shoot the two of them - at a discounted rate - and the buddies get back to business. (During one unplanned, comical moment, the client tells the two girls he'd like to see them "69" and both have a difficult time figuring out how to assume the position). 4.5 1 2009-05-15 Mature Adult Nopornlifeboyfriendamateurjoinpoorshootcindyplayedgirlfriendpositiontwo girlsleavesbusiness http://www.iphods.com/movie/714/disciplinarian-librarian/ http://www.iphods.com/videos/ad1f8237f671b7f06c3f7e678dca126c.m4v http://www.iphods.com/clips/thumbs/ad1f8237f671b7f06c3f7e678dca126c.jpg Disciplinarian Librarian In Disciplinarian Librarian, Jewell receives a summons to the Central Library to account for 22 books, which have been missing for five years. The Librarian (Mistress Gemini) insists that Jewell either produce the pilfered literature at once, or submit to immediate corporal punishment for her wantonly selfish behavior. Jewell doesn't question the Librarian's authority but attempts to assuage the implacable disciplinarian before her with facile excuses for her behavior. But it won't wash. Jewell has deprived the other members of the library of access to such books as Frank and I and The Story of O for years. Letting the punishment fit the crime, The Librarian sets out to paddle some ethics into the casual sensualist, while describing additional humiliations to follow. In addition to being paddled and spanked and strapped and caned, Jewell is told to prepare herself for double penetration by a pair of pink vibrating ovoids connected to a battery pack which The Librarian intends to control. And what is m 4 1 2009-05-09 Mature Adult Nobondagepunishmentpainleatherbodymistresspleasurenicecaningwomenwomandoublevideoveryanaldoessubmissivespankedfemalecamerabottomspanksstyleerotichighnaughtyropesecretpaddlehotterstory,oral,razor,masturbation,jewell,spread,male,ends,librarian,crime,taken,paddled,large,marceau,table,books,pair,severe,fans,jewell m http://www.iphods.com/movie/714/disciplinarian-librarian/ http://www.iphods.com/videos/03a7c2572222a33ae124ae3168aba193.m4v http://www.iphods.com/clips/thumbs/03a7c2572222a33ae124ae3168aba193.jpg Disciplinarian Librarian In Disciplinarian Librarian, Jewell receives a summons to the Central Library to account for 22 books, which have been missing for five years. The Librarian (Mistress Gemini) insists that Jewell either produce the pilfered literature at once, or submit to immediate corporal punishment for her wantonly selfish behavior. Jewell doesn't question the Librarian's authority but attempts to assuage the implacable disciplinarian before her with facile excuses for her behavior. But it won't wash. Jewell has deprived the other members of the library of access to such books as Frank and I and The Story of O for years. Letting the punishment fit the crime, The Librarian sets out to paddle some ethics into the casual sensualist, while describing additional humiliations to follow. In addition to being paddled and spanked and strapped and caned, Jewell is told to prepare herself for double penetration by a pair of pink vibrating ovoids connected to a battery pack which The Librarian intends to control. And what is m 4 1 2009-05-09 Mature Adult Nobondagepunishmentpainleatherbodymistresspleasurenicecaningwomenwomandoublevideoveryanaldoessubmissivespankedfemalecamerabottomspanksstyleerotichighnaughtyropesecretpaddlehotterstory,oral,razor,masturbation,jewell,spread,male,ends,librarian,crime,taken,paddled,large,marceau,table,books,pair,severe,fans,jewell m http://www.iphods.com/movie/716/vintage-xxx-cartoons/ http://www.iphods.com/videos/84d490ec2c958bb9534cbe6445e58c6d.m4v http://www.iphods.com/clips/thumbs/84d490ec2c958bb9534cbe6445e58c6d.jpg Vintage XXX Cartoons These aren't your ordinary Saturday morning cartoons... The BEST of rare, vintage, and hard to find XXX cartoons... All of the classic favorites...fro, TV to Print... Take this journey down memory lane, but this time with a twist!!! This is a must have for fans and collectors alike... 2.5 1 2009-05-09 Mature Adult Nofavoriteclassicfans http://www.iphods.com/movie/725/punished-office-girl/ http://www.iphods.com/videos/be07da81359a2424be5cc02e459bd666.m4v http://www.iphods.com/clips/thumbs/be07da81359a2424be5cc02e459bd666.jpg Punished Office Girl Haughty Foxy is pulled into Dan's playroom dressed office clothing. Her arms are hoisted overhead and Dan spreads her legs wide as he fondles her ripe body. He slowly removes her clothing and cuts her panties away, stuffing them in her mouth and draping them in place. A crotch rope is added and we enjoy her struggles. We see her next in a crotchless bodysuit. She is tied to a stool as a rope splits her pussy and sinks deep between her lips. This is one tight crotch rope! Now a nude Foxy is a spread-eagled and Dan adds steel clamps to her nipples, crimping them tight. Her pussy lips are clamped with mousetraps and a dowel rod is shoved against her open cunt, pulling her labia tautly. After that Foxy experiences the joy of a classic hogtie, Dan crops her a little just for extra fun. For her last scene, Foxy is bent into a strappado position and Dan works her ass over with floggers, crops and a cane. This babe is completely broken. 3 1 2009-04-30 Mature Adult Nopussytightbodyexperiencetieddeepplaylegsropecrotchnipplesofficeextralipsclassicpantiescuntcompletelyspreadnippleworksslowlycompleteposition http://www.iphods.com/movie/736/elbow-bound-bitches/ http://www.iphods.com/videos/3c0258b6dc67c36419333cfaf3ec1b09.m4v http://www.iphods.com/clips/thumbs/3c0258b6dc67c36419333cfaf3ec1b09.jpg Elbow Bound Bitches I tie them up so their elbows are touching. They are so helpless that way! When I have them like this I cant do anything I want to them! Sometimes I force them to cum for my own amusement using vibrators, dildos or what ever I have lying around. You are going to love these Elbow Bound Bitches. 4.5 1 2009-04-24 Mature Adult Noboundanythingdildobitchesvibratordildoshelpless http://www.iphods.com/movie/736/elbow-bound-bitches/ http://www.iphods.com/videos/05c7ab92922d8d6af889f8c2f01762fa.m4v http://www.iphods.com/clips/thumbs/05c7ab92922d8d6af889f8c2f01762fa.jpg Elbow Bound Bitches I tie them up so their elbows are touching. They are so helpless that way! When I have them like this I cant do anything I want to them! Sometimes I force them to cum for my own amusement using vibrators, dildos or what ever I have lying around. You are going to love these Elbow Bound Bitches. 2 1 2009-04-24 Mature Adult Noboundanythingdildobitchesvibratordildoshelpless http://www.iphods.com/movie/736/elbow-bound-bitches/ http://www.iphods.com/videos/423124873c44837fd5ff1246ede805de.m4v http://www.iphods.com/clips/thumbs/423124873c44837fd5ff1246ede805de.jpg Elbow Bound Bitches I tie them up so their elbows are touching. They are so helpless that way! When I have them like this I cant do anything I want to them! Sometimes I force them to cum for my own amusement using vibrators, dildos or what ever I have lying around. You are going to love these Elbow Bound Bitches. 3 1 2009-04-24 Mature Adult Noboundanythingdildobitchesvibratordildoshelpless http://www.iphods.com/movie/741/max-portrait-of-a-serial-fucker-2/ http://www.iphods.com/videos/a6f725fe41492b2cdfd38d0a7b9d4979.m4v http://www.iphods.com/clips/thumbs/a6f725fe41492b2cdfd38d0a7b9d4979.jpg Max - Portrait Of A Serial Fucker 2 Released as "Max Portrait D'Un Serial Niqueur 2" From California to Paris, Clara Morgane follows Fred Coppula, who brings perpetual fame to Max's new phallic conquests in thirteen mind-blowing hardcore scenes. A dream casting. A huge budget gave the directors free rein to their wild imaginations. Join Max on his quest for the perfect pussy. 2.5 1 2009-04-21 Mature Adult Nopussyhardcorehugejoinmindblowreleasedirectorfree http://www.iphods.com/movie/741/max-portrait-of-a-serial-fucker-2/ http://www.iphods.com/videos/37a96be2955af71fb20a87f332af341e.m4v http://www.iphods.com/clips/thumbs/37a96be2955af71fb20a87f332af341e.jpg Max - Portrait Of A Serial Fucker 2 Released as "Max Portrait D'Un Serial Niqueur 2" From California to Paris, Clara Morgane follows Fred Coppula, who brings perpetual fame to Max's new phallic conquests in thirteen mind-blowing hardcore scenes. A dream casting. A huge budget gave the directors free rein to their wild imaginations. Join Max on his quest for the perfect pussy. 3 1 2009-04-21 Mature Adult Nopussyhardcorehugejoinmindblowreleasedirectorfree http://www.iphods.com/movie/744/dance-macabre/ http://www.iphods.com/videos/cb083de1d5b3344fc3ae3d7307717f71.m4v http://www.iphods.com/clips/thumbs/cb083de1d5b3344fc3ae3d7307717f71.jpg Dance Macabre On a dark and stormy night, pretty Cindy huddled by her TV for a quiet night at home alone. After drifting off to sleep, she was suddenly awakened by a thunderous crash. The TV picture pulsated wildly, apparently struck by lightning. That's when the show came on, Dance Macabre. Those were the words on the screen when she awoke. She wanted to go back to sleep, but she couldn't seem to look away from the TV. Cindy felt as if she was being pulled into a trance. The movie started out so normal, but that was before the bizarre torture chamber and the supernatural attack on the buxom blonde private eye. Stripped naked by an unseen force, mouth stuffed with a rag and duct taped, the poor PI is then pinned spread-eagle as the evil force has its way with her. While the supernatural power probes her squirming body, it also controls her mind, making her hallucinate a hideously masked attacker and his invisible accomplices holding her spread for his brutal onslaught. Then, the movie really gets scary. Whip wielding zom 2.5 1 2009-04-17 Mature Adult Noboundbodyhornywildprettyblondemouthtorturenightgaggeddildonaturalsecretuseddarkalonewhipmindpoorrubberspreadnakeddildosbizarrecindygagspowerstuffedfloorstripped http://www.iphods.com/movie/747/sista-25/ http://www.iphods.com/videos/e791b31724a106d6f79374c3b232a308.m4v http://www.iphods.com/clips/thumbs/e791b31724a106d6f79374c3b232a308.jpg Sista 25 The Silver Edition of Afro-Centric's best-selling, all girl, all chocolate series is here! Director Jax has captured brand new hotties Nia and Candice Nicole, Sinnamon Love's Sista debut, Miss Tia's big round ass, Stacy Adams' big, natural titties, and a sizzling lezbolicious 5-girl orgy! 2 1 2009-04-17 Mature Adult Nonaturalhottieschocolatedirectororgy http://www.iphods.com/movie/747/sista-25/ http://www.iphods.com/videos/0bb74f5eef2fed8a15f6ef1106a5c3d5.m4v http://www.iphods.com/clips/thumbs/0bb74f5eef2fed8a15f6ef1106a5c3d5.jpg Sista 25 The Silver Edition of Afro-Centric's best-selling, all girl, all chocolate series is here! Director Jax has captured brand new hotties Nia and Candice Nicole, Sinnamon Love's Sista debut, Miss Tia's big round ass, Stacy Adams' big, natural titties, and a sizzling lezbolicious 5-girl orgy! 3.5 1 2009-04-17 Mature Adult Nonaturalhottieschocolatedirectororgy http://www.iphods.com/movie/752/girls-playing-with-girls/ http://www.iphods.com/videos/d9a33fbc2252d318985ecd7c387f142c.m4v http://www.iphods.com/clips/thumbs/d9a33fbc2252d318985ecd7c387f142c.jpg Girls Playing With Girls Marigold and Theresa love to play. Taking pics of each other with a mobile phone, things quickly get raunchy. The result is outstanding erotic sex. Marigold even gets pics of herself licking out Theresa, and the girls have lots of fun. An extremely passionate scene with some of the best oral sex on DVD. Multiple orgasms. Real orgasms. Nothing is faked, staged or directed! Bonus! Marigold and Theresa in "Before" and "After" interviews. And a hilarious and sexy behind-the-scenes extra of Marigold in a broken shower, and Theresa describing a pre-shoot gyno visit. Another bonus! An intense, full-on sex scene with Shelly and Belinda. Wild, edgy sex driven by lust and raw desire, resulting in bliss and genuine orgasms. 3.5 1 2009-04-10 Mature Adult Nogirlslovesexyevenorgasmorgasmsbehindhellintenseeroticlickingextraoralpassionatebonusshootsex sceneextremeviewphone http://www.iphods.com/movie/763/haarig-schwanger/ http://www.iphods.com/videos/745fde1d0418b4531522109b45669666.m4v http://www.iphods.com/clips/thumbs/745fde1d0418b4531522109b45669666.jpg Haarig Schwanger If big round bellies and lactating beasts are your thing, then we have five hot scenes full of preggo poontang for your prick pulling pleasure! Check out these horny hotties who cant get enough cock into their swollen pregnant gashes! Some kinky penetrations and awesome cum shots "round" out this round belly bash! 2.5 1 2009-03-28 Mature Adult Nohornypleasurekinkyhottiespenetration http://www.iphods.com/movie/764/women-of-all-ages-edition-6/ http://www.iphods.com/videos/60b3efc72529cbd8e72433d4e9d673fc.m4v http://www.iphods.com/clips/thumbs/60b3efc72529cbd8e72433d4e9d673fc.jpg Women Of All Ages Edition 6 Women of all ages crave sex. Sit back and enjoy as we bring you women in their 20's, 30's, 40's, 50's, and 60's all getting fucked silly. These woman have one thing in common, they all love cock! Let the ageless ladies give you a ride you'll never forget!! 2.5 1 2009-03-28 Mature Adult Noladieswomanride http://www.iphods.com/movie/776/black-pipe-layers-5/ http://www.iphods.com/videos/df4cd63917341d98c8f91d471daa17fd.m4v http://www.iphods.com/clips/thumbs/df4cd63917341d98c8f91d471daa17fd.jpg Black Pipe Layers 5 2008 AVN Award Nominee for Best Interracial Release. Make sure you give this one a look-see because this is the last Black Pipe Layers Justin Slayer will ever make! Watch as these beautiful bitches take a long black rod like it was what they were born to do. They had to save the best for last, the grand finale! 3 1 2009-03-24 Mature Adult Nobeautifulblacknomineebitchesavn awardaward nomineeinterracial http://www.iphods.com/movie/776/black-pipe-layers-5/ http://www.iphods.com/videos/e5fdd9706ff58f19f471282d697b7cc4.m4v http://www.iphods.com/clips/thumbs/e5fdd9706ff58f19f471282d697b7cc4.jpg Black Pipe Layers 5 2008 AVN Award Nominee for Best Interracial Release. Make sure you give this one a look-see because this is the last Black Pipe Layers Justin Slayer will ever make! Watch as these beautiful bitches take a long black rod like it was what they were born to do. They had to save the best for last, the grand finale! 4 1 2009-03-24 Mature Adult Nobeautifulblacknomineebitchesavn awardaward nomineeinterracial http://www.iphods.com/movie/777/chunky-chicks-38/ http://www.iphods.com/videos/250250e506a1b804bdbc115aa3898d2e.m4v http://www.iphods.com/clips/thumbs/250250e506a1b804bdbc115aa3898d2e.jpg Chunky Chicks #38 Most like them chunky... And here we have them fucking for you! Loads of meaty chicks, who are all more than willing to take that huge cock in their mouth and work it like it's a spicy Italian sausage, then slob it up really dirty and stick it in their chubby little cooter! 5 1 2009-03-24 Mature Adult Nocockfuckingmouthdirtyhugewilling http://www.iphods.com/movie/780/rubber-maid-service/ http://www.iphods.com/videos/3be7f6c90b39595e55f44dbfed5cb282.m4v http://www.iphods.com/clips/thumbs/3be7f6c90b39595e55f44dbfed5cb282.jpg Rubber Maid Service It is the dream of many of those with fetishes to be feminized by an adorable rubber goddess transformed into a sissy maid or perfect rubber doll. Many men carry this female part inside, but never let it happen. In our film, two of them can live it out to the max! Three dominant latex ladies take good care of them!! Enjoy!! 4 1 2009-03-13 Mature Adult Noladiesfilmfetishfemalethreerubbergoddesslatexmale http://www.iphods.com/movie/780/rubber-maid-service/ http://www.iphods.com/videos/86ca7232bba9586464b3a9d557fa29ec.m4v http://www.iphods.com/clips/thumbs/86ca7232bba9586464b3a9d557fa29ec.jpg Rubber Maid Service It is the dream of many of those with fetishes to be feminized by an adorable rubber goddess transformed into a sissy maid or perfect rubber doll. Many men carry this female part inside, but never let it happen. In our film, two of them can live it out to the max! Three dominant latex ladies take good care of them!! Enjoy!! 3 1 2009-03-13 Mature Adult Noladiesfilmfetishfemalethreerubbergoddesslatexmale http://www.iphods.com/movie/788/annie-sprinkle-the-original-squirter/ http://www.iphods.com/videos/e8160d4e91e128931f5df922f5c72da6.m4v http://www.iphods.com/clips/thumbs/e8160d4e91e128931f5df922f5c72da6.jpg Annie Sprinkle - The Original Squirter The girls of yesteryear are back to show you how it all started! Annie Sprinkle IS the Original Squirter, and she's here to show us all how to get a dirty slut to cum and spray it ALL over the place. Annie really is the Queen of Kink, and she's getting filthy nasty just waiting for you! 4 1 2009-03-07 Mature Adult Nogirlsnastyslutdirtysquirtoriginalqueenfilthy http://www.iphods.com/movie/790/st-thrashmore-school-for-girls/ http://www.iphods.com/videos/174d4c37543b49489e393040bf9ba2af.m4v http://www.iphods.com/clips/thumbs/174d4c37543b49489e393040bf9ba2af.jpg St. Thrashmore School For Girls Tasha Lee is the new teacher at St. Thrashmore's, an extremely exclusive school for girls. As part of her orientation, headmistress Kelly Payne explains to Ms. Lee that discipline is strict at St. Thrashmore and infractions of the rules are dealt with by the use of corporal punishment. When Ms. Lee questions the use of spanking, she is informed that she is expected to conform, and spanking of the girls will be required of her. That expectation is tested a short time later when Ms. Lee catches two girls smoking in the yard while classes are in session. After leading the naughty pair, Chrystyne and Adele Phi, to the punishment room, Ms Lee attempts to discipline the two with somewhat comedic results. A short time later, an angry Headmistress Payne enters the room. Watching on a closed circuit monitor from her office, she has seen the two teenagers pull the wool over the eyes of their unsuspecting teacher. Using the bare bottoms of the two girls, Ms. Payne take the opportunity to show Ms. Lee just exactly how di 2.5 1 2009-03-06 Mature Adult Nogirlsspankingpunishmentschoolmistressbottomkellynaughtyeyesshortsurpriseofficeoralsmokingassesextremeshockedcloseunsuspectingtwo girlsteacherpair http://www.iphods.com/movie/790/st-thrashmore-school-for-girls/ http://www.iphods.com/videos/883ccbb3ca00e64f1fb84fab501a6c67.m4v http://www.iphods.com/clips/thumbs/883ccbb3ca00e64f1fb84fab501a6c67.jpg St. Thrashmore School For Girls Tasha Lee is the new teacher at St. Thrashmore's, an extremely exclusive school for girls. As part of her orientation, headmistress Kelly Payne explains to Ms. Lee that discipline is strict at St. Thrashmore and infractions of the rules are dealt with by the use of corporal punishment. When Ms. Lee questions the use of spanking, she is informed that she is expected to conform, and spanking of the girls will be required of her. That expectation is tested a short time later when Ms. Lee catches two girls smoking in the yard while classes are in session. After leading the naughty pair, Chrystyne and Adele Phi, to the punishment room, Ms Lee attempts to discipline the two with somewhat comedic results. A short time later, an angry Headmistress Payne enters the room. Watching on a closed circuit monitor from her office, she has seen the two teenagers pull the wool over the eyes of their unsuspecting teacher. Using the bare bottoms of the two girls, Ms. Payne take the opportunity to show Ms. Lee just exactly how di 2 1 2009-03-06 Mature Adult Nogirlsspankingpunishmentschoolmistressbottomkellynaughtyeyesshortsurpriseofficeoralsmokingassesextremeshockedcloseunsuspectingtwo girlsteacherpair http://www.iphods.com/movie/790/st-thrashmore-school-for-girls/ http://www.iphods.com/videos/cf8d9cd4cf6c9825f83d878a0689dc08.m4v http://www.iphods.com/clips/thumbs/cf8d9cd4cf6c9825f83d878a0689dc08.jpg St. Thrashmore School For Girls Tasha Lee is the new teacher at St. Thrashmore's, an extremely exclusive school for girls. As part of her orientation, headmistress Kelly Payne explains to Ms. Lee that discipline is strict at St. Thrashmore and infractions of the rules are dealt with by the use of corporal punishment. When Ms. Lee questions the use of spanking, she is informed that she is expected to conform, and spanking of the girls will be required of her. That expectation is tested a short time later when Ms. Lee catches two girls smoking in the yard while classes are in session. After leading the naughty pair, Chrystyne and Adele Phi, to the punishment room, Ms Lee attempts to discipline the two with somewhat comedic results. A short time later, an angry Headmistress Payne enters the room. Watching on a closed circuit monitor from her office, she has seen the two teenagers pull the wool over the eyes of their unsuspecting teacher. Using the bare bottoms of the two girls, Ms. Payne take the opportunity to show Ms. Lee just exactly how di 2.5 1 2009-03-06 Mature Adult Nogirlsspankingpunishmentschoolmistressbottomkellynaughtyeyesshortsurpriseofficeoralsmokingassesextremeshockedcloseunsuspectingtwo girlsteacherpair http://www.iphods.com/movie/792/house-of-shame/ http://www.iphods.com/videos/fd8efa24d7927852619e79dcbd9f340f.m4v http://www.iphods.com/clips/thumbs/fd8efa24d7927852619e79dcbd9f340f.jpg House Of Shame Welcome to the dark and twisted world of Tanya Hyde. Enter the House of Shame and leave your inhibitions at the door. Fulfill all of your fetish fantasies in five hot scenes that leave nothing to the imagination when these sexy fuckers explore every deviation they can think of at a giant feast, in the laboratory, in the classroom, and during an abduction. Enjoy the show! 4.5 1 2009-03-06 Mature Adult Nosexyveryfetishdoordarkfantasies http://www.iphods.com/movie/792/house-of-shame/ http://www.iphods.com/videos/7f490b0f49a888e3d41f53326bf2d976.m4v http://www.iphods.com/clips/thumbs/7f490b0f49a888e3d41f53326bf2d976.jpg House Of Shame Welcome to the dark and twisted world of Tanya Hyde. Enter the House of Shame and leave your inhibitions at the door. Fulfill all of your fetish fantasies in five hot scenes that leave nothing to the imagination when these sexy fuckers explore every deviation they can think of at a giant feast, in the laboratory, in the classroom, and during an abduction. Enjoy the show! 4.5 1 2009-03-06 Mature Adult Nosexyveryfetishdoordarkfantasies http://www.iphods.com/movie/794/black-goddess-vol-2/ http://www.iphods.com/videos/2a3a5a9d6b126e10cddbc861c1034ae1.m4v http://www.iphods.com/clips/thumbs/2a3a5a9d6b126e10cddbc861c1034ae1.jpg Black Goddess Vol. 2 5 Bomb diggity scenes with the choicest honey dips on da block! Candace Von has a body from heaven!!! big all natural titties curvy sleek body with booty! Wesley Pipes has a fun time shoving his big ol' black snake and choco nuts in her mouth! Oh girl takes the whole package and deep throats! Before getting fucked real hard! Anita Waters and Cinnabunz have a nasty three way with Byron Long. Pursuajon and Tony get down. Pursua is a curly weave cutie looking like she walked straight outta drill team. Great athletic body!! and big c naturals! Cameron Luv and Sledge play hide the baby gorilla arm! Roxxie drops it like it's hot for tatted dude on da pool table. Dude sinks that 8 ball in her corner pocket hard as fuck!!! 2 1 2009-03-06 Mature Adult Nonastybodyplayblackthreenaturalbootypooltable http://www.iphods.com/movie/794/black-goddess-vol-2/ http://www.iphods.com/videos/c45270a78146b8d9086dd9d3446d4e17.m4v http://www.iphods.com/clips/thumbs/c45270a78146b8d9086dd9d3446d4e17.jpg Black Goddess Vol. 2 5 Bomb diggity scenes with the choicest honey dips on da block! Candace Von has a body from heaven!!! big all natural titties curvy sleek body with booty! Wesley Pipes has a fun time shoving his big ol' black snake and choco nuts in her mouth! Oh girl takes the whole package and deep throats! Before getting fucked real hard! Anita Waters and Cinnabunz have a nasty three way with Byron Long. Pursuajon and Tony get down. Pursua is a curly weave cutie looking like she walked straight outta drill team. Great athletic body!! and big c naturals! Cameron Luv and Sledge play hide the baby gorilla arm! Roxxie drops it like it's hot for tatted dude on da pool table. Dude sinks that 8 ball in her corner pocket hard as fuck!!! 3.5 1 2009-03-06 Mature Adult Nonastybodyplayblackthreenaturalbootypooltable http://www.iphods.com/movie/815/inner-city-black-cheerleader-search-90/ http://www.iphods.com/videos/c384a7835b71b0ab7affa008b56a31c5.m4v http://www.iphods.com/clips/thumbs/c384a7835b71b0ab7affa008b56a31c5.jpg Inner City Black Cheerleader Search 90 Sure they want the team to win, but what they want most are those big, hard cocks crammed deep inside their wet, pink pussies! So join us for a sweet, dark chocolate orgy in the locker room tonight and see just how much these little sluts love getting showered in huge loads of cum! 4.5 1 2009-02-13 Mature Adult Nocockdeepcocksnighthugejoindarkchocolatehard cockorgydeep inside http://www.iphods.com/movie/765/double-air-bags-23/ http://www.iphods.com/videos/feb68354fc66387d712369bd73bfa2c0.m4v http://www.iphods.com/clips/thumbs/feb68354fc66387d712369bd73bfa2c0.jpg Double Air Bags #23 The biggest tits in the USA! Check out these slut's enormous funbags and take em' for a ride, we guarantee your complete satisfaction! Watch these beauties pop out of their straining bras and bounce their boobs up and down, just for you! Then get crazy with a titty fuck and let loose with a hot, gooey facial! 4 1 2009-03-28 Mature Adult Notitsslutridetrainingboobscompletebiggest http://www.iphods.com/movie/833/bathroom-bitches/ http://www.iphods.com/videos/069a301dc8e246c833197135abd61416.m4v http://www.iphods.com/clips/thumbs/069a301dc8e246c833197135abd61416.jpg Bathroom Bitches Dirty filthy sex is what were all about check out these dirty little sluts and what gets them off. These girls love to suck cock and get dirty in crazy places watch in this rare 5-hour specialty. And by special we mean dirty, when these girls cum over there is no need to clean your house. Enjoy! 2.5 1 2009-01-24 Mature Adult Nococksuckslutdirtycleansuck cockfilthy http://www.iphods.com/movie/834/my-virtual-adulteress-adriana/ http://www.iphods.com/videos/c0014cb2c8f270022027f0b8f130d913.m4v http://www.iphods.com/clips/thumbs/c0014cb2c8f270022027f0b8f130d913.jpg My Virtual Adulteress - Adriana Your best friend's wife is a pain in the ass. She won't let him hang out with the guys or watch the games on TV anymore. Basically, she's a bitch. And you know why: your buddy's not getting the job done in the sack. You can help out. Be a sport and fuck HIS WIFE! Bang the shit out of this bitch and restore the balance of the universe! 3.5 1 2009-01-24 Mature Adult Nopainguyswifegamescallbang http://www.iphods.com/movie/840/auf-die-knie-mit-den-spermasauen/ http://www.iphods.com/videos/e4d13ee5b5bcd4976a6c3691dd372260.m4v http://www.iphods.com/clips/thumbs/e4d13ee5b5bcd4976a6c3691dd372260.jpg Auf Die Knie Mit Den Spermasauen! These women are extremely sexy and ready to suck cock. This guy lets you see it from his point of view. These ladies are sucking him, until he explodes onto their faces. Then they swallow each and every drop. Cum watch what he has created for you...you can see it, how he sees it! 2.5 1 2009-01-18 Mature Adult Noladiessuckingwomensuck cockfacesextremeview http://www.iphods.com/movie/843/cream-pie-pov-9/ http://www.iphods.com/videos/f28dc8be70d51cf179054511a70742c7.m4v http://www.iphods.com/clips/thumbs/f28dc8be70d51cf179054511a70742c7.jpg Cream Pie P.O.V. 9 Sure it's great pumping a huge load of cum deep inside some sexy slut's gooey hole! But you know what's even better? Watching her spread that snatch so every thick drop of your steaming load can ooze out until the whole mess runs down her legs! But if you're not sure, we're going to let you check it out with this edition of CREAM PIE P.O.V.... Now you can see it all for yourself with our P.O.V. cameras that show you every massive load of jizz up close and very personal, just as though it was your cum all along! Who knows... It just might be! 3.5 1 2009-01-10 Mature Adult Nodeepevenslutlegscamerathickhugemassivepumpspreadclosedeep inside http://www.iphods.com/movie/853/banging-the-pool-boy/ http://www.iphods.com/videos/7f433025fc930ea9e1a54070fae62795.m4v http://www.iphods.com/clips/thumbs/7f433025fc930ea9e1a54070fae62795.jpg Banging The Pool Boy Banging the Pool Boy is full of action! Big cocks pumping hot loads of juicy cums on these hot chicks is on a high display. They want you to feed mouths, asses, and the fat juicy pussies with your big dick. They make sure no cum is dropped as they fuck and rock your world. 5 1 2009-01-03 Mature Adult Nodickplaypussiescockschickshighjuicymouthscumschickassespoolpumpbang http://www.iphods.com/movie/856/smack-attack/ http://www.iphods.com/videos/b3739c70ad1d5010419b8d62b435c6bb.m4v http://www.iphods.com/clips/thumbs/b3739c70ad1d5010419b8d62b435c6bb.jpg Smack Attack Scorched video knows fetish and pain and this is no exception. Two separate stories, one with a submissive male the other with a submissive female. Both get spanked and flogged until their ass cheeks are swelling red and the pain is obvious. Watch her tie the man up, gag him and spank the snot out of him! 5 1 2009-12-28 Mature Adult Nopainfetishsubmissivespankedfemalemale http://www.iphods.com/movie/867/ultimate-texan-shemale-kourtney/ http://www.iphods.com/videos/144cd7626f60371bc98ba4b1343c35c8.m4v http://www.iphods.com/clips/thumbs/144cd7626f60371bc98ba4b1343c35c8.jpg Ultimate Texan Shemale - Kourtney Kourtney is a full-bodied woman, big tits, round ass... so full-bodied that she even has a big cock! With nine very functional inches -- Kourtney's always going to leave an impression! Everything is bigger in Texas and Kourtney is here to prove it! This is one big 'un! 3.5 1 2009-12-14 Mature Adult Notitswomanevenalwaysinches http://www.iphods.com/movie/867/ultimate-texan-shemale-kourtney/ http://www.iphods.com/videos/ca96f3021b40d1316e01cce64b26459e.m4v http://www.iphods.com/clips/thumbs/ca96f3021b40d1316e01cce64b26459e.jpg Ultimate Texan Shemale - Kourtney Kourtney is a full-bodied woman, big tits, round ass... so full-bodied that she even has a big cock! With nine very functional inches -- Kourtney's always going to leave an impression! Everything is bigger in Texas and Kourtney is here to prove it! This is one big 'un! 3 1 2009-12-14 Mature Adult Notitswomanevenalwaysinches http://www.iphods.com/movie/867/ultimate-texan-shemale-kourtney/ http://www.iphods.com/videos/8d83c86d86ddf74e9ee415b1b86b560c.m4v http://www.iphods.com/clips/thumbs/8d83c86d86ddf74e9ee415b1b86b560c.jpg Ultimate Texan Shemale - Kourtney Kourtney is a full-bodied woman, big tits, round ass... so full-bodied that she even has a big cock! With nine very functional inches -- Kourtney's always going to leave an impression! Everything is bigger in Texas and Kourtney is here to prove it! This is one big 'un! 2.5 1 2009-12-14 Mature Adult Notitswomanevenalwaysinches http://www.iphods.com/movie/868/transsexual-beauty-queens-hung-honeys-1/ http://www.iphods.com/videos/e48e15bb703a7975a186b398c2314dee.m4v http://www.iphods.com/clips/thumbs/e48e15bb703a7975a186b398c2314dee.jpg Transsexual Beauty Queens - Hung Honey's #1 Are you in that randy mood for some WELL HUNG HONEYS? If you are than tune in and be prepared to be amazed and entertained at the lengths that these Trannys will go to please you with their deviant form of fetish-0fueled hardcore action!! Cum have some illicit fun!! 4.5 1 2009-12-14 Mature Adult Nohardcorefetishtranny http://www.iphods.com/movie/868/transsexual-beauty-queens-hung-honeys-1/ http://www.iphods.com/videos/b630cd56ac61d4323adb9c74f34bcc35.m4v http://www.iphods.com/clips/thumbs/b630cd56ac61d4323adb9c74f34bcc35.jpg Transsexual Beauty Queens - Hung Honey's #1 Are you in that randy mood for some WELL HUNG HONEYS? If you are than tune in and be prepared to be amazed and entertained at the lengths that these Trannys will go to please you with their deviant form of fetish-0fueled hardcore action!! Cum have some illicit fun!! 3.5 1 2009-12-14 Mature Adult Nohardcorefetishtranny http://www.iphods.com/movie/872/2-big-2-be-true-6/ http://www.iphods.com/videos/ee18c38a173fa6eafa77ac03a75113eb.m4v http://www.iphods.com/clips/thumbs/ee18c38a173fa6eafa77ac03a75113eb.jpg 2 Big 2 Be True #6 These white bitches will never get all of that big black dick into their mouths. Or up their tight pink slits and tiny assholes. These monster DP's are gonna create stretch marks and leave these girls unable to sit for weeks! It's like a human shish kabob! Bon appetit bitches! 2.5 1 2009-12-14 Mature Adult Nogirlsdickblackwhitemouthholesassholesbitchesmouthsassholebig blackmonster http://www.iphods.com/movie/872/2-big-2-be-true-6/ http://www.iphods.com/videos/8abdea21b2fd00ae9efafb39ed415d60.m4v http://www.iphods.com/clips/thumbs/8abdea21b2fd00ae9efafb39ed415d60.jpg 2 Big 2 Be True #6 These white bitches will never get all of that big black dick into their mouths. Or up their tight pink slits and tiny assholes. These monster DP's are gonna create stretch marks and leave these girls una